SecReT6
Protein ID: 538392857
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06270
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]693212..694243 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDT1X4C9
KEGG IDvpd:VAPA_1c06270
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-20, Aligned region: 57..116
Protein Sequence: 343 a.a.     [Download]
>gi|538392857|ref|YP_008514430.1| type VI secretion-associated protein, ImpA family [Variovorax paradoxus B4]
MLTNELVDALLTPIGEASPCGDDLEYDAAFTALTTAAQGKPEQQFGDTVIAAVEPEWREVAEQSDAILRR
SKDVRAAVLLLRASTRLQGVAGFVAGLQLLIGLLDKFWDGIHPKLDAEDDNDPTMRLNALAPLGDETMVL
RDLYDAQVGVAPGVGAIRVRDIAVANNALNAVGGEATYSPAQIQGGLEALHAERPELIQAAIGVPGLVEK
LQALLVERTGRSDAIDLSPLRTIGRMLQKACSAAIGAPEEAGAAEETQGDSPQAGGAPRPAAARGEIQSR
QDALQMLDRVIRFLEQTEPGNPAPLLIERAKKLIGVSFLEIMANLAPGALDTIETVTGKRPSE
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c694243-693212 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCTGACCAACGAACTTGTCGACGCCCTGCTCACGCCCATCGGCGAGGCCTCGCCGTGCGGCGACGATC
TGGAGTACGACGCGGCCTTCACCGCGCTCACCACCGCAGCGCAGGGCAAGCCCGAGCAGCAGTTCGGCGA
CACCGTCATTGCCGCGGTGGAACCGGAGTGGCGCGAGGTGGCCGAGCAGTCCGACGCGATCCTGCGCCGC
AGCAAGGACGTGCGCGCCGCCGTGCTGCTGCTGCGCGCCTCCACGCGGCTGCAGGGCGTGGCCGGCTTCG
TGGCCGGGCTCCAGCTGTTGATCGGCCTGCTCGACAAGTTCTGGGACGGCATACATCCAAAGCTCGATGC
CGAGGACGACAACGATCCGACGATGCGCCTGAACGCGCTCGCGCCGCTCGGCGACGAGACGATGGTCCTG
CGCGACCTGTACGACGCGCAGGTGGGCGTGGCGCCCGGCGTGGGCGCGATCCGCGTGCGCGACATCGCGG
TGGCCAACAACGCTTTGAATGCGGTGGGCGGCGAAGCCACCTATTCGCCGGCACAGATCCAGGGCGGCCT
CGAAGCGCTCCATGCCGAGCGGCCCGAACTGATCCAGGCCGCCATCGGCGTGCCCGGCCTGGTCGAGAAG
CTGCAGGCCCTGCTGGTGGAGCGCACCGGCCGCTCCGACGCGATCGACCTCTCCCCGCTGCGCACCATCG
GCCGCATGCTGCAGAAGGCCTGCAGCGCCGCCATCGGTGCACCGGAAGAAGCCGGCGCCGCCGAAGAAAC
ACAAGGCGATTCCCCGCAGGCCGGCGGCGCGCCTCGGCCCGCTGCCGCGCGTGGCGAGATCCAGAGCCGG
CAGGACGCACTGCAGATGCTGGACCGGGTGATCCGCTTTCTCGAACAGACCGAGCCCGGCAACCCCGCGC
CGCTCCTGATCGAGCGCGCCAAGAAGCTCATCGGCGTGAGCTTTCTCGAAATCATGGCCAACCTCGCGCC
CGGCGCGCTGGACACGATCGAGACCGTGACCGGCAAGCGCCCGTCCGAGTAG
 Primer design