SecReT6
Protein ID: 538392858
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06280
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]694315..694827 [+]
Productputative type VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDT1X585
KEGG IDvpd:VAPA_1c06280
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-41, Aligned region: 33..165
Protein Sequence: 170 a.a.     [Download]
>gi|538392858|ref|YP_008514431.1| putative type VI secretion lipoprotein, VC_A0113 family [Variovorax paradoxus B4]
MRTLGTHHSSYGRSFAAVSRRLALACGLVLTGALIAGCASKPVVTPVSITLAAGSDANPDARGRASPLTV
RIYALKSPGPFEGADFFSLFEKDQATLGAELVQREEMLLRPGESRKLDLTLPADAKAIGVMAAFRDLDRA
RWREVRAVEPGKPQTLTVTFGARQIRIDSK
 
Nucleotide Sequence: 513 bp     [Download]
>gi|538392231|ref|NC_022247.1|:694315-694827 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCGCACGCTGGGTACACACCATTCGTCCTATGGACGCTCTTTTGCTGCGGTCTCGCGGCGTCTTGCAC
TGGCCTGCGGCCTGGTATTGACCGGTGCCCTGATCGCAGGCTGCGCAAGCAAGCCCGTGGTCACGCCGGT
GTCGATCACGCTCGCGGCCGGTTCCGATGCCAACCCCGATGCGCGCGGCCGCGCATCGCCGCTTACAGTG
CGCATCTATGCGCTGAAGTCGCCCGGCCCCTTCGAAGGGGCCGACTTCTTCTCGCTGTTCGAAAAGGACC
AGGCCACGCTTGGCGCCGAGCTGGTGCAGCGCGAAGAGATGCTGCTGCGCCCGGGCGAAAGCAGGAAGCT
CGACCTCACCCTGCCGGCCGATGCCAAGGCCATCGGCGTGATGGCCGCGTTCCGCGACCTCGACCGTGCG
CGCTGGCGCGAAGTGCGCGCCGTGGAGCCCGGCAAGCCGCAGACGCTCACCGTGACCTTCGGCGCCCGGC
AGATCCGCATCGACAGCAAGTGA
 Primer design