SecReT6
Protein ID: 538392859
SecReT6 ID846
T6SS typei3
Gene symbol-
Locus tagVAPA_1c06290
StrainVariovorax paradoxus B4
Repliconchromosome I [GenBank: NC_022247] [Browse all T6SS(s) in this replicon]
Location [Strand]694847..695965 [-]
ProductImcF-like N-terminal domain-containing protein
NoteTssM
UniProt IDT1X5Z6
KEGG IDvpd:VAPA_1c06290
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.80E-35, Aligned region: 149..338
ImcF-related_N [PF14331], Evalue: 6.80E-35, Aligned region: 334..362
Protein Sequence: 372 a.a.     [Download]
>gi|538392859|ref|YP_008514432.1| ImcF-like N-terminal domain-containing protein [Variovorax paradoxus B4]
MPAALSSAHFFWLLLALCLAGFALLYATVRDAGRGARRRALRRRIAALGPPAAEPDEAAVEAMRDAMSHA
RQLLRQPPRQQAAPVPWLLFLGDAAANLPGLLAAAHAEHLAPSGSEPFGEPYWRWWLTGSMTAIELHPSA
VSDVAAAPHTRALWLQALLALAERRDRVPINGVVVCVAASELLHPASAGMKPLATRMRRLLDEAAETLRL
RLPVYLVVTGLEQLAGYATLRGALPPEVLAQVIGHRLAGAAAHGETAAERLDALFDPMARQLHALRMALL
REQPSASGRLAIHEFVEALRALQPALRQVADALFESHGRGSRGPRWRGLYLTAAASGAAGGAFVTDLFER
FLPADQPLARPGRPPNANAAKA
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|538392231|ref|NC_022247.1|:c695965-694847 Variovorax paradoxus B4 chromosome 1, complete sequence
ATGCCCGCCGCGCTGTCGTCCGCCCATTTCTTCTGGCTCCTGCTCGCGCTGTGCCTGGCCGGTTTTGCAC
TGCTGTACGCCACGGTCCGCGACGCCGGCCGCGGTGCGCGCCGCCGTGCGCTGCGCCGGCGCATTGCCGC
GCTCGGCCCACCGGCGGCCGAACCCGACGAAGCCGCGGTCGAAGCCATGAGGGACGCCATGTCGCACGCA
CGCCAGCTCCTGCGCCAGCCACCGCGGCAGCAAGCCGCGCCGGTGCCCTGGCTCCTCTTCCTCGGCGATG
CGGCGGCCAACCTGCCGGGGCTGCTGGCGGCGGCCCATGCCGAGCACCTGGCACCTTCAGGCAGCGAACC
TTTCGGCGAACCGTACTGGCGCTGGTGGCTCACCGGTTCGATGACGGCCATCGAGCTTCACCCGAGCGCC
GTCAGCGACGTGGCCGCGGCGCCGCACACGCGCGCGCTGTGGCTCCAGGCACTCCTCGCACTGGCCGAGC
GGCGCGACCGCGTGCCGATCAACGGCGTGGTGGTCTGCGTGGCAGCGAGCGAACTGCTGCACCCGGCCAG
CGCAGGCATGAAGCCGCTGGCCACCAGGATGCGCCGGCTGCTCGACGAGGCCGCGGAGACCCTGCGCCTG
CGGCTGCCGGTCTACCTGGTCGTGACCGGGCTGGAGCAGCTGGCCGGCTATGCCACGCTGCGCGGCGCGC
TGCCGCCCGAGGTGCTCGCACAGGTGATCGGCCATCGCCTGGCCGGAGCTGCCGCCCATGGCGAGACGGC
GGCCGAACGGCTCGATGCCCTGTTCGATCCCATGGCGCGCCAGCTGCATGCGCTGCGGATGGCGCTGCTG
CGCGAACAGCCGAGTGCATCGGGCCGGCTCGCGATCCATGAGTTCGTCGAGGCGCTGCGTGCGCTGCAAC
CCGCATTGCGCCAGGTGGCCGACGCCCTGTTCGAAAGCCATGGCCGCGGCTCGCGCGGCCCGCGATGGCG
CGGCCTCTATCTCACAGCCGCTGCATCGGGCGCGGCCGGCGGCGCGTTCGTGACCGATCTGTTCGAGCGC
TTCCTGCCCGCCGACCAACCGCTCGCACGGCCCGGCCGTCCGCCGAACGCCAACGCGGCAAAGGCGTGA
 Primer design