SecReT6
Protein ID: 541870636
SecReT6 ID847
T6SS typei1
Gene symbol-
Locus tagM892_22435
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1027251..1030640 [-]
ProductT6SS/membrane protein (IcmF-like) VasK
NoteTssM
UniProt IDA7N2A8
KEGG IDvha:VIBHAR_05857
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.20E-55, Aligned region: 153..411
IcmF-related [PF06761], Evalue: 8.30E-48, Aligned region: 205..231
IcmF-related [PF06761], Evalue: 8.30E-48, Aligned region: 494..755
DUF1215 [PF06744], Evalue: 2.80E-31, Aligned region: 866..987
Protein Sequence: 1129 a.a.     [Download]
>gi|541870636|ref|YP_008529043.1| T6SS/membrane protein (IcmF-like) VasK [Vibrio campbellii ATCC BAA-1116]
MFKQKILRNPILVSTIVALLLAAIFAAVYLFLLEDADKLYLWIGLGVISAFYLIFQLSLWFKKKNNSKAQ
RLETEEEALSMVIRPLLSHSGKKPIYLMIGNKGSGRRQFLFNSSAIKPMDRSRTAKNDFFEWYESDGAVY
VKPDQRLVFQEVSSSDASLWNTFVDEVIRHRPRKPFSGCLFFTDFEFMIVSEPEQKDYTITALLQRLSSI
SEKTSSALPVYLMMSKLDKLDGFKEYVHFSSLKTRVEFLSIPLKEAKGVITEYYRDGYRNLVKVLESNAL
DASANSTDIDEKQAILSFPKQFELCQAEISYVLERLCDVNSGTYSLDIREIFFCSSLQGGRKYNLLAKSC
SNYFNLPIIASEHTQLTETPYFSRFLIDSQILPESDFAGENKTYLRLIQRQSHLAMLASVILLAGGTYFF
VTTLDSNLRVINQLLGIDDNGQVEQEASFNQLLVNATRAIQPSYSAWLEGSRALDEEVLPLNISRLDQST
RLAYEALLKEVAQQLMPVVEKGYRLELTHNQHDVAATLPLLKGYLMLNDRSKRDIQFLRRQTLQTLNDLS
DKPDVVNQAMRYLDAYFRTQFAPVDINMDIVRATRRSLLANSNVDLVYAGILNQADAIDLGTLDLQRAVG
FEFNNVFNEPLDDNRLVIDKVYTSTGFSTFYRPRVDLMSQQVISDNWVLGLSNHVIPTKQEQDAFKTQVR
KKYTDDYINYWRNALSELRVQHYSNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKNALIANVN
PKLAEVADTASEAVEEAVQPDYLLMKRVEQAFHLLNQLQVSETPNSPTPWDETIAALSRVRTYMKDIADA
PDPQMAALAAAQHRMNSTEADPLIKLKQIAQKSPEPVRNWLLDVVQQSWSVMIAESAKGIQTQWYSEIYT
KFKELGLGKYPFDLNATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTNLWTPKQVDGETMPLSPALLV
QLRNYNVIRDTLINKSTNRVYIPFSAKVLDLDSSAIRATLKISDTDINYYHGPSRIREMEWPPQNGDFNI
SITIQDVTDEGKQHVLNKSGQWAIYRLLGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAEL
YNFTLPESI
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|541870142|ref|NC_022270.1|:c1030640-1027251 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGTTCAAACAAAAAATACTAAGAAACCCGATTTTGGTTTCTACCATAGTGGCTTTGCTATTAGCCGCGA
TATTTGCAGCAGTGTATTTATTCTTACTTGAAGATGCAGATAAGCTATATCTATGGATTGGCCTTGGCGT
CATTTCTGCATTTTATCTTATATTCCAGTTGTCACTATGGTTTAAGAAAAAGAACAACTCGAAAGCCCAA
CGTTTGGAAACCGAGGAAGAAGCCCTTTCTATGGTTATCCGCCCTCTTCTTTCTCATTCAGGCAAGAAAC
CAATCTACCTAATGATTGGTAATAAGGGGTCTGGCCGACGTCAATTTTTGTTTAATTCAAGCGCAATTAA
ACCAATGGATCGTTCTCGCACTGCAAAAAACGATTTCTTTGAATGGTATGAATCTGACGGTGCGGTTTAT
GTAAAACCAGACCAACGCCTCGTATTCCAAGAAGTATCCAGTAGTGATGCTTCATTGTGGAACACGTTTG
TTGATGAGGTTATTCGTCACCGTCCAAGAAAACCGTTTTCTGGCTGTTTATTTTTTACTGACTTTGAGTT
CATGATCGTCTCAGAACCAGAGCAAAAAGATTACACCATTACCGCACTATTGCAGCGCCTAAGTTCTATT
AGCGAAAAAACATCATCGGCACTACCAGTTTATTTGATGATGTCTAAGCTTGATAAGTTGGACGGTTTCA
AAGAGTACGTACATTTCAGTTCTCTGAAAACTCGTGTGGAATTCCTTTCTATTCCTCTTAAAGAAGCGAA
AGGCGTCATCACTGAATACTACCGAGATGGTTACCGTAATCTGGTGAAAGTACTGGAAAGCAATGCTCTG
GACGCTTCTGCAAATTCGACAGACATCGATGAAAAACAAGCTATTCTGTCATTCCCGAAACAGTTCGAGC
TTTGCCAAGCAGAAATCAGTTACGTCCTTGAGCGTCTTTGCGATGTGAACAGCGGCACTTATTCGCTCGA
CATTCGTGAGATCTTTTTCTGCTCTAGCTTACAAGGTGGTCGTAAGTACAACCTGTTAGCAAAAAGCTGC
AGCAATTACTTTAATTTGCCGATCATTGCTTCAGAGCACACACAGCTGACAGAAACGCCTTACTTCTCTC
GCTTCCTGATTGACTCTCAGATTTTGCCTGAGAGCGATTTTGCGGGTGAAAACAAAACGTATTTACGCTT
AATCCAACGTCAAAGTCATTTGGCCATGTTAGCGTCCGTGATCTTGTTGGCTGGCGGTACCTACTTCTTT
GTTACCACACTAGACAGTAACTTGCGTGTGATTAACCAATTGCTTGGTATTGATGACAACGGTCAGGTTG
AACAAGAAGCAAGCTTCAATCAGCTTCTCGTAAACGCCACTCGCGCTATTCAACCTTCGTACAGTGCATG
GCTAGAAGGCTCTCGAGCTCTAGATGAAGAAGTGCTTCCACTGAACATTAGCCGCTTGGACCAAAGCACA
CGTCTGGCTTACGAAGCACTGCTTAAAGAAGTGGCACAACAGCTTATGCCCGTCGTTGAAAAAGGCTACC
GTCTAGAGTTGACGCATAACCAACATGACGTTGCCGCGACACTGCCATTGCTAAAAGGCTACTTGATGCT
GAACGATCGCTCAAAGCGTGACATTCAGTTCCTACGTCGCCAGACCTTGCAAACCCTTAATGATTTAAGC
GATAAGCCGGATGTAGTAAACCAGGCAATGCGCTATTTAGACGCTTATTTCCGTACTCAGTTTGCGCCTG
TTGATATCAATATGGACATTGTTCGTGCCACTCGCCGTTCTTTACTGGCGAACTCTAACGTCGACCTTGT
TTATGCGGGTATTTTGAATCAAGCCGATGCTATCGACCTTGGTACGCTAGATCTTCAACGCGCTGTTGGC
TTTGAGTTCAACAACGTGTTTAATGAACCGCTAGACGACAACCGCTTAGTGATTGACAAAGTCTACACGT
CTACTGGCTTTAGCACCTTCTATCGCCCTCGTGTGGACCTGATGTCACAGCAAGTTATCAGCGATAACTG
GGTTCTTGGCTTGTCTAATCACGTGATCCCTACGAAACAAGAGCAGGATGCGTTTAAGACACAGGTACGT
AAGAAATACACCGATGACTACATCAACTACTGGCGTAATGCACTGAGTGAACTGAGAGTACAGCATTACA
GCAATGTGGGCGACTTGACGAATGCAATCGACCTTATTTCTGGTCCGTCTTCTCCAATGACGACTGTATT
AAAACAAGTGTACGCGAACACCCAGTTTTCTCCGGTTGGTGAAAAGAATGCATTAATTGCCAATGTAAAC
CCTAAGCTAGCGGAAGTTGCAGATACGGCCTCAGAAGCAGTAGAAGAAGCCGTACAGCCAGATTACTTAC
TGATGAAGCGTGTTGAGCAAGCCTTCCACTTGTTAAACCAACTTCAAGTCAGTGAGACACCTAACTCCCC
GACTCCATGGGATGAAACCATTGCAGCATTAAGCCGTGTTCGTACTTACATGAAAGACATCGCTGATGCA
CCAGATCCACAAATGGCCGCACTTGCAGCAGCGCAACACCGCATGAACAGTACAGAAGCGGATCCGCTTA
TCAAACTGAAGCAGATCGCGCAGAAGTCTCCAGAGCCAGTGCGTAACTGGTTACTTGATGTGGTACAGCA
AAGCTGGTCAGTGATGATTGCTGAGTCCGCAAAAGGCATTCAAACCCAATGGTACAGCGAGATTTACACC
AAGTTTAAAGAGCTAGGGCTTGGTAAATACCCATTTGATCTGAACGCGACAGAAGAGATTTCAATTGAAG
ACTTCGAGCTGTTGTTCGCATCAGGTGGTTTGTTAGATACGTTTATTCAGAAGAACTTCGCACCGTTCTA
CGATACAAACTTGTGGACACCAAAGCAGGTGGATGGCGAGACAATGCCTCTTTCGCCTGCCCTATTGGTG
CAATTGCGCAATTACAACGTTATCCGCGATACGTTGATCAACAAGAGCACAAACCGAGTTTATATCCCGT
TCAGCGCGAAAGTATTAGACCTTGATTCCAGTGCTATCCGAGCCACTCTGAAAATTTCAGACACGGATAT
CAACTACTATCATGGTCCGAGCCGAATTCGTGAGATGGAGTGGCCGCCGCAGAACGGTGACTTCAACATT
AGTATCACGATCCAAGATGTGACAGACGAGGGCAAGCAGCACGTTCTTAATAAGAGTGGTCAGTGGGCGA
TATACAGATTGCTAGGTGATTCGACCCTGACAAACACTCATAACGGTAGCTTCGTCAGTGACATAAAAGT
GTCTGGAAGGGACTTAAGCCTTCGTATCACTCCTTTGACACAGAAAAACCCCTTCACTCTTGCTGAGCTG
TATAACTTTACACTCCCTGAGTCGATTTAA
 Primer design