SecReT6
Protein ID: 54307865
SecReT6 ID78
T6SS typei5
Gene symbol-
Locus tagPBPRA0662
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]726552..730097 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ6LUE2
KEGG IDppr:PBPRA0662
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.30E-90, Aligned region: 70..133
ImcF-related_N [PF14331], Evalue: 2.30E-90, Aligned region: 198..461
IcmF-related [PF06761], Evalue: 4.20E-87, Aligned region: 510..813
DUF1215 [PF06744], Evalue: 5.70E-37, Aligned region: 924..1043
Protein Sequence: 1181 a.a.     [Download]
>gi|54307865|ref|YP_128885.1| hypothetical protein PBPRA0662 [Photobacterium profundum SS9]
MKFIKRLVGGLVDMLRQKWVITLLGLIALSLLIWFGGPLVAIAGVEPLNSQVSRLTVLLILAVLWGLYNV
FHQARNKKQNEQTVKTLLNGDEAKPADEASQKEIETLRARIVQALDVLHKTSGKRGRNIYHLPWYILIGP
PGTGKTTALQNSGLEFPLQESLGSDPLAGIGGTRYCDWWFTNKAVLIDTAGRYTTQDSNNEQDSRAWLGF
LGLLKKYRTRRPINGAVITVSLTNLLTQTRTERNLHARAIKQRILELKNQLGMQFPVYVILTKADLVAGF
NEFFADLDRPAREQIWGITFPEDTLDFEQGVVSLFNKEFHHLLTGLLEKMNHRLSNERDIDKRTLIYEFP
KQLRLLQAAADDFLKEIFSANAFEEPPMLRGVFIASATQEGVPIDRVMKETAGGLGLSQVPLRQAGGEAK
GFFIKNLFEDVIIKEQLLGTVNRVHQKQNRWFNRSVIVASCAVILVMAFIWSRSYQWNKSLVDEAGIFID
KYHAVVGEYLTPEHDVVSLVDALNVLQNLPAGFNQHMLNEDGIKHFGLYQGEKLGQPAVSAYHQALQSVF
AQFLVSGLEEEMQENKQHREYLYETLKTYLMLFNPQYYDATQVNSWFAAYFEREYPGEINLELRTALLEH
SANLQHDGVLSVSQSDTVVESARTVLTAMPLSERAYQRLKLEFIDSHIPSFRLTDVLGSKSVSIFERKSG
KPLSMGIPGLYTYNGFHGVFQLEINRMVKRLMEERWVYGDNLVLQDNMSDQVVRDVRFKYYRDYIYEWTQ
LLNDLQLKPYQSAEQGLAQAKILAGPERPVESLIMAVQKQLKLSEVQISEKVKVAGKVTASVANVALNNQ
KHRIGRYLPSDLGDTKITLPGKEVESAFDELLTVSEAQLEDIHTSFVKLNNYLADLTSSGNNERIAYNSL
LGEISKQTVGSAMKSARANLPYPFSSWLGNISSQTTKLAKKGSQIHVNDIWQSTVLKEYQSLIAGKYPFD
PKSTKDLPLKDFERFFGYGGTLDAFFNQYLAPFVDKSKRRWRFDKSIGLNDESLRVFARAEKIRKAFFDA
GSKTASVSFGIKPIYLDQHISHFKLEVGKQAVTYQHGPTRAKTLHWPNSGQTRVVFTPPQTGHVVTETYG
GSWGLFRLLDKSLKARPKSRKDNILMVDLKGNKAQLELIPNSAINPFWSREMERFSCPVTL
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|54307237|ref|NC_006370.1|:726552-730097 Photobacterium profundum SS9 chromosome 1, complete genome
ATGAAATTTATTAAGCGTTTAGTCGGTGGTTTAGTTGATATGTTAAGGCAAAAGTGGGTTATTACACTGT
TGGGACTAATTGCCCTATCACTATTAATTTGGTTTGGTGGCCCATTGGTCGCAATTGCGGGTGTCGAACC
TTTAAATAGCCAAGTCTCTCGCCTAACGGTATTGCTTATATTGGCGGTGCTTTGGGGGCTTTATAACGTA
TTCCATCAAGCAAGAAATAAAAAGCAAAATGAACAAACAGTAAAAACGTTGCTTAATGGCGATGAGGCAA
AACCAGCAGATGAAGCTTCTCAAAAAGAAATAGAAACCCTCCGTGCTCGTATAGTGCAGGCGTTGGATGT
ATTACATAAAACGTCAGGTAAACGTGGGCGTAATATTTACCATTTACCTTGGTATATTTTAATTGGGCCT
CCGGGTACAGGTAAAACGACCGCTTTACAAAATTCGGGGCTAGAGTTTCCATTGCAAGAGAGTTTAGGGA
GCGACCCTTTAGCGGGGATTGGCGGAACTCGGTATTGTGATTGGTGGTTCACAAATAAAGCTGTGCTGAT
AGATACCGCAGGTCGTTATACCACGCAAGATAGTAATAACGAACAAGATTCCCGAGCGTGGTTAGGTTTT
CTTGGCTTATTAAAAAAGTACCGTACCCGCCGTCCGATTAATGGTGCGGTTATCACGGTGAGTTTAACTA
ATTTACTTACGCAAACACGTACTGAAAGAAATCTTCATGCCAGGGCTATTAAGCAAAGAATTCTTGAATT
AAAAAATCAGCTCGGAATGCAATTTCCTGTTTATGTGATTTTGACTAAAGCAGATTTAGTCGCGGGCTTT
AACGAGTTCTTTGCAGATTTAGATCGCCCAGCCCGTGAGCAAATTTGGGGTATTACTTTCCCAGAAGACA
CGTTAGATTTCGAGCAAGGCGTCGTGAGCTTGTTTAATAAGGAATTCCATCATTTATTGACGGGATTGCT
TGAGAAAATGAATCATAGACTGAGCAATGAACGTGATATTGATAAAAGAACGTTGATCTATGAATTTCCG
AAGCAGTTACGCCTACTTCAAGCTGCTGCGGATGATTTTCTGAAAGAGATTTTTTCGGCAAATGCGTTTG
AAGAGCCACCTATGTTACGCGGTGTATTTATTGCCAGTGCGACTCAAGAAGGTGTGCCAATTGATCGGGT
AATGAAGGAAACAGCAGGAGGCTTAGGGTTAAGCCAAGTTCCACTTCGACAAGCTGGCGGAGAAGCGAAA
GGCTTTTTCATTAAAAATCTCTTTGAAGATGTCATCATCAAAGAACAGTTGTTGGGCACAGTTAATCGTG
TTCACCAAAAGCAAAATCGTTGGTTTAATCGTTCAGTGATAGTGGCAAGTTGCGCTGTTATTTTGGTGAT
GGCTTTTATCTGGAGTCGAAGCTATCAATGGAATAAATCATTGGTCGATGAAGCCGGAATATTTATCGAC
AAATATCATGCGGTAGTGGGTGAATATTTAACGCCAGAGCATGACGTTGTAAGCCTTGTCGATGCCTTGA
ATGTTTTACAGAACTTACCTGCTGGGTTTAATCAGCACATGTTAAATGAAGATGGGATAAAGCATTTTGG
TTTATACCAAGGTGAGAAACTCGGCCAGCCCGCAGTGTCTGCTTATCATCAAGCATTACAAAGTGTTTTT
GCTCAGTTCCTCGTTTCAGGTCTTGAAGAAGAGATGCAAGAGAATAAGCAGCATCGTGAGTATTTGTACG
AAACGCTTAAAACATATCTGATGCTATTTAATCCTCAGTATTATGATGCTACGCAAGTGAATAGTTGGTT
TGCCGCTTATTTTGAACGCGAATATCCTGGTGAAATTAATCTGGAGTTACGTACTGCATTGTTAGAACAC
AGTGCAAATTTACAGCATGATGGAGTATTGAGCGTTTCTCAAAGCGATACGGTCGTTGAAAGTGCTCGTA
CAGTGTTAACGGCAATGCCTTTATCTGAACGTGCATACCAGCGTTTGAAGCTCGAGTTTATAGATAGCCA
CATACCATCATTTAGACTAACCGATGTGCTTGGATCTAAGAGTGTGAGTATCTTTGAACGTAAGAGTGGT
AAGCCACTGAGTATGGGTATTCCAGGCTTATATACCTATAACGGTTTTCATGGTGTTTTTCAGCTTGAAA
TTAACCGGATGGTTAAACGCTTAATGGAAGAACGTTGGGTCTACGGTGATAATTTAGTCTTGCAAGATAA
TATGTCTGATCAGGTTGTGCGTGATGTAAGGTTTAAGTATTACCGTGATTACATTTATGAATGGACGCAA
CTACTTAATGATTTGCAGTTAAAACCTTATCAATCTGCTGAACAAGGGCTGGCACAAGCCAAAATTCTAG
CGGGGCCTGAACGCCCTGTCGAGAGCTTAATTATGGCTGTTCAAAAACAGTTAAAATTAAGTGAAGTGCA
AATCAGTGAAAAAGTTAAAGTTGCCGGTAAGGTTACAGCAAGTGTTGCTAACGTCGCTTTAAATAATCAA
AAACATCGTATTGGTCGATACCTGCCATCGGATCTTGGTGACACTAAAATTACCTTGCCCGGCAAAGAAG
TTGAATCAGCCTTTGATGAGCTACTTACTGTTTCAGAAGCGCAGTTAGAAGATATACATACATCGTTCGT
CAAACTGAATAATTATTTAGCTGACTTAACCAGCTCTGGTAATAATGAGCGAATTGCTTATAACAGTTTA
TTGGGTGAAATCTCAAAGCAGACTGTCGGCTCAGCGATGAAATCGGCACGCGCTAATTTGCCTTATCCAT
TCTCTAGTTGGCTTGGCAATATTTCGTCACAAACCACCAAGCTTGCTAAGAAAGGCTCCCAGATTCATGT
CAATGATATTTGGCAATCAACGGTACTTAAAGAATATCAATCGCTAATTGCTGGAAAATACCCATTCGAT
CCTAAATCGACTAAAGACTTACCGTTGAAAGACTTTGAACGTTTCTTTGGCTATGGCGGAACGTTAGATG
CATTTTTTAATCAGTATTTAGCCCCGTTTGTTGATAAGTCCAAGCGTCGATGGCGTTTTGATAAATCGAT
TGGACTCAATGACGAAAGTCTTCGAGTGTTTGCGCGTGCTGAAAAGATCCGTAAAGCCTTCTTTGATGCG
GGCAGCAAAACAGCGAGTGTGAGCTTTGGGATCAAGCCTATCTATCTTGATCAACATATCAGTCATTTCA
AGCTCGAAGTGGGTAAACAAGCCGTGACTTATCAACATGGCCCAACGCGTGCGAAAACATTGCACTGGCC
AAATTCAGGGCAAACTCGAGTTGTATTTACCCCTCCGCAAACAGGCCATGTGGTAACAGAAACGTATGGT
GGTAGTTGGGGGTTATTCAGGCTATTAGATAAGTCATTAAAAGCGAGACCAAAATCTCGTAAAGACAATA
TTTTGATGGTTGATTTAAAAGGGAATAAAGCTCAATTGGAGTTGATTCCTAATAGTGCAATTAATCCATT
TTGGTCTCGAGAAATGGAGCGTTTTTCATGTCCAGTGACACTATAG
 Primer design