SecReT6
Protein ID: 543974108
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3977
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]976228..978906 [-]
Productputative ClpA/B-type protease
NoteTssH
UniProt IDT2C2V4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.90E-45, Aligned region: 219..269
AAA_2 [PF07724], Evalue: 5.90E-45, Aligned region: 626..790
AAA [PF00004], Evalue: 1.60E-22, Aligned region: 220..348
AAA [PF00004], Evalue: 1.60E-22, Aligned region: 631..755
AAA_16 [PF13191], Evalue: 5.80E-15, Aligned region: 195..235
AAA_16 [PF13191], Evalue: 5.80E-15, Aligned region: 262..296
AAA_16 [PF13191], Evalue: 5.80E-15, Aligned region: 404..503
AAA_16 [PF13191], Evalue: 5.80E-15, Aligned region: 602..653
AAA_16 [PF13191], Evalue: 5.80E-15, Aligned region: 695..724
AAA_16 [PF13191], Evalue: 5.80E-15, Aligned region: 852..867
ClpB_D2-small [PF10431], Evalue: 8.10E-15, Aligned region: 797..872
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 220..238
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 292..348
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 630..788
AAA_22 [PF13401], Evalue: 9.30E-10, Aligned region: 218..314
AAA_22 [PF13401], Evalue: 9.30E-10, Aligned region: 628..743
Sigma54_activat [PF00158], Evalue: 1.20E-06, Aligned region: 218..276
Sigma54_activat [PF00158], Evalue: 1.20E-06, Aligned region: 434..470
Sigma54_activat [PF00158], Evalue: 1.20E-06, Aligned region: 630..751
AAA_17 [PF13207], Evalue: 5.40E-06, Aligned region: 220..283
AAA_17 [PF13207], Evalue: 5.40E-06, Aligned region: 462..462
AAA_17 [PF13207], Evalue: 5.40E-06, Aligned region: 629..653
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 218..245
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 272..313
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 626..662
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 212..240
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 630..650
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 740..760
Zeta_toxin [PF06414], Evalue: 7.40E-05, Aligned region: 140..211
Zeta_toxin [PF06414], Evalue: 7.40E-05, Aligned region: 218..236
Zeta_toxin [PF06414], Evalue: 7.40E-05, Aligned region: 298..340
Zeta_toxin [PF06414], Evalue: 7.40E-05, Aligned region: 629..670
NACHT [PF05729], Evalue: 9.70E-05, Aligned region: 220..245
NACHT [PF05729], Evalue: 9.70E-05, Aligned region: 277..318
NACHT [PF05729], Evalue: 9.70E-05, Aligned region: 630..655
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 215..239
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 627..652
Arch_ATPase [PF01637], Evalue: 0.00069, Aligned region: 198..231
Arch_ATPase [PF01637], Evalue: 0.00069, Aligned region: 270..303
Arch_ATPase [PF01637], Evalue: 0.00069, Aligned region: 629..651
RuvB_N [PF05496], Evalue: 0.00073, Aligned region: 218..235
RuvB_N [PF05496], Evalue: 0.00073, Aligned region: 273..298
RuvB_N [PF05496], Evalue: 0.00073, Aligned region: 582..652
AAA_18 [PF13238], Evalue: 0.00093, Aligned region: 221..240
AAA_18 [PF13238], Evalue: 0.00093, Aligned region: 495..533
AAA_18 [PF13238], Evalue: 0.00093, Aligned region: 631..659
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 220..239
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 631..652
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 732..749
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 188..236
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 629..651
AAA_33 [PF13671], Evalue: 0.0089, Aligned region: 219..235
AAA_33 [PF13671], Evalue: 0.0089, Aligned region: 416..440
AAA_33 [PF13671], Evalue: 0.0089, Aligned region: 629..650
AAA_23 [PF13476], Evalue: 0.0097, Aligned region: 220..235
AAA_23 [PF13476], Evalue: 0.0097, Aligned region: 435..494
AAA_23 [PF13476], Evalue: 0.0097, Aligned region: 628..742
Protein Sequence: 892 a.a.     [Download]
>gi|543974108|ref|YP_008548854.1| putative ClpA/B-type protease [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MININLSSLIQRLHPIAKVALEDAAALAVSEKANEVQIEHYLLSLLERPNSDFDVLLSHFDCSENLLRQS
VRSTLDTNAKGNGSKPVFSALLIEWLQESWLVSSLDLSETQIRSGALLLTLVSNPLRYGQHGYASILEAV
NPDSLKRNFAELTSHSIEAQVANSEKTQAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIVDILA
RRRKNNPIAVGEPGVGKTAVVEGLALKIVQGDVPDNLKGVELYGLDMGLLQAGASVKGEFEKRLNAVLDE
VKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRFQL
VKLDEPSPEQAALIIRGLRPAYEKSHNVYVRDDAITAAAALSARYISGRQLPDKAIDVLDTACARVNISL
NAIPASVETLQQELAAQQRELEALERDALQQTGDKHSLANIPDLKLAMETTKEELAEQEAQWHKEKEQIQ
EMIALRSRLHELVFGETNEEELVADEDSEQEQDVSPYAEMDEEAVRIAISACQEQLDVIRNGNPLVHFEV
GPDEVSHVISDWTGIPMGKMLQDEAETTLKLKESLTQSIKGQEYAIDALSEGIQTAKAGLGNPDAPTGVF
LLVGPSGVGKTETARAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPY
SVVLLDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVHQSKDIDANIIA
EAIRPTLNQHFKPALLARMSVLPFVPLSDEAMTEIIHHKLNKVSQRLQSHHKLSLSYEESLVEFVLGNCR
LAETGARNIDAVINRQLLPQLSTQLLVHDKDDSHTQIEVSVDEQGTLTYAFS
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c978906-976228 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGATAAATATAAACCTTTCTTCATTAATTCAGCGTCTACACCCGATTGCAAAAGTAGCATTAGAAGACG
CCGCTGCACTTGCAGTCTCTGAAAAAGCAAACGAAGTTCAAATTGAGCATTATTTACTGAGTCTATTAGA
AAGGCCAAATAGTGATTTTGACGTCTTATTAAGTCATTTTGATTGTTCTGAGAACTTATTAAGACAATCG
GTTCGATCCACACTCGACACCAACGCCAAAGGAAATGGCAGCAAACCTGTTTTTTCTGCTTTATTAATCG
AATGGTTGCAAGAAAGCTGGCTGGTTTCTTCTTTAGATCTATCCGAAACACAAATCCGCTCTGGCGCCCT
GCTCCTTACTCTTGTTAGCAATCCTCTCCGTTACGGCCAACATGGTTATGCCTCTATCCTTGAGGCGGTA
AATCCTGACAGCCTTAAGCGTAACTTTGCAGAACTAACAAGCCACTCTATTGAGGCGCAAGTTGCTAATT
CAGAGAAAACACAAGCTCGTGAGGATGGCTCAGCACTGAGCAAGTTCACGACAGACTTCACTGGTAAAGC
ACGCAAAGGCGAAATCGATCCTGTTTTCTGCCGTGACCAAGAAATCCGCCAAATCGTGGACATTCTTGCT
CGTCGCCGTAAAAACAACCCTATTGCTGTTGGTGAACCGGGCGTTGGTAAAACCGCAGTAGTAGAAGGCT
TGGCACTTAAGATTGTACAAGGTGACGTACCAGACAACCTCAAAGGTGTTGAGCTTTACGGCCTGGACAT
GGGTCTTCTGCAAGCTGGTGCAAGCGTAAAAGGCGAATTCGAAAAACGCCTAAACGCAGTATTGGATGAA
GTGAAAAACTCGCCAACCCCTATCATTCTTTTCATCGATGAAGCACACACCCTTGTTGGCGGTGGTAACC
AAGCGGGCGGCAGCGACGCGGCAAACTTGCTAAAACCAGCCCTAGCGCGTGGTGAAGTGAAAACCATCGC
TGCGACAACATGGTCGGAATACAAGAAGTACTTCGAGAAAGATCCTGCTCTTGCGCGTCGTTTCCAATTG
GTGAAACTCGACGAACCGTCTCCTGAGCAAGCAGCATTGATCATTCGTGGTCTGCGCCCAGCATACGAGA
AGTCACATAACGTTTACGTGCGTGACGATGCTATCACTGCTGCGGCAGCACTTTCTGCTCGTTACATCTC
TGGTCGTCAACTGCCAGACAAAGCGATCGATGTACTAGATACGGCGTGTGCACGAGTGAACATCAGCCTT
AATGCCATTCCTGCTTCTGTTGAGACTCTGCAACAAGAACTTGCAGCTCAACAGCGCGAGCTTGAAGCAC
TTGAGCGTGATGCTCTGCAGCAAACTGGCGACAAGCACAGCCTTGCTAACATTCCAGACCTAAAACTGGC
AATGGAAACAACGAAAGAAGAGCTAGCAGAACAAGAAGCGCAATGGCACAAAGAAAAAGAGCAGATCCAA
GAGATGATTGCTCTACGCTCTCGCTTACATGAACTGGTCTTTGGAGAAACAAATGAAGAAGAGCTTGTTG
CAGACGAAGATTCAGAACAAGAGCAAGACGTTTCTCCATATGCAGAAATGGATGAAGAAGCCGTTCGCAT
TGCCATTTCGGCCTGCCAAGAACAGCTAGATGTAATCCGCAATGGCAACCCACTGGTTCACTTTGAAGTG
GGCCCAGATGAAGTTAGCCACGTCATCTCGGACTGGACTGGTATTCCAATGGGTAAGATGCTTCAAGACG
AAGCAGAAACCACGCTAAAACTGAAAGAAAGCCTAACACAAAGCATCAAAGGCCAAGAATACGCTATCGA
TGCACTGTCTGAAGGCATTCAAACTGCGAAAGCTGGTCTAGGTAACCCAGACGCACCAACAGGCGTATTC
CTGCTGGTTGGCCCAAGTGGCGTGGGTAAAACCGAAACGGCTCGTGCGATCGCTGATCAAATGTTTGGTG
GTGAGCGCTTTATGACGACCATTAACATGTCTGAGTTCCAAGAGAAGCACACGGTATCTCGCCTAATCGG
TTCTCCTCCGGGTTACGTAGGTTACGGTGAAGGCGGCATGCTGACAGAAGCGGTTCGTCAACGTCCATAT
TCTGTTGTTCTTCTTGATGAAGTGGAAAAAGCCGACCCTGAAGTGTTGAACCTGTTCTACCAAGTGTTCG
ACAAAGGCACGCTGAACGACGGCGAAGGCCGCACAATCGACTTCAAGAACACGCTGATCATCATGACCAG
TAACCTTGCGACGCATGAGATCGAATCTTTGGTTCATCAATCCAAAGACATCGATGCAAACATCATCGCA
GAAGCTATTCGCCCTACTTTGAACCAACACTTCAAGCCGGCGCTGTTGGCACGTATGTCAGTACTACCAT
TTGTTCCGCTGTCTGATGAAGCAATGACAGAAATTATTCACCACAAGCTGAACAAAGTTTCTCAGCGTCT
ACAGAGTCATCACAAGTTGTCTCTGAGCTACGAAGAAAGCTTGGTTGAGTTCGTACTAGGTAACTGTCGC
CTTGCTGAAACGGGCGCGCGTAACATCGACGCGGTCATCAACCGTCAGTTGCTGCCGCAACTATCGACTC
AGCTATTAGTGCATGACAAGGATGATTCACATACGCAAATCGAAGTGTCTGTCGATGAGCAAGGAACACT
AACCTATGCGTTCAGCTAA
 Primer design