SecReT6
Protein ID: 543974109
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3978
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]979363..979881 [+]
ProductBfdA
NoteTssD
UniProt IDU2ZQ44
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.50E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|543974109|ref|YP_008548855.1| BfdA [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MPTPAYMSIQGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVV
TKVQDRSSPLLFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVT
EEVLKFTYRAIEVTHENCGTAGNDDWRAPREA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|543973209|ref|NC_022359.1|:979363-979881 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGCCAACTCCAGCATATATGTCTATCCAAGGTGAGACTCAAGGCCATATTACTAAAGATACTTACTCTG
CAGATTCAGTAGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTACAAGAACTTGATCACGT
GCTAACTGTTCCACGTGATCCACAAAGTGGTCAGCCAACTGGTCAACGTGTACACCGTCCACTTGTTGTA
ACTAAAGTTCAAGATCGCTCATCTCCACTACTATTCAACGCACTAGTATCTGGCGAAAAACTTCCTGAGT
GTGTGATCCGCTTCTACCGTACTTCAGTTCAAGGTAAACAAGAGCACTACTACTCAATCAAATTGATTGA
TGCGCTACTTGTCGATATCCAAACTCGTATGAACCACTGTCAAGACGCAGCAACAGCTGACCGCGTGACA
GAAGAAGTGCTTAAGTTCACTTACCGTGCGATCGAAGTAACTCACGAAAACTGTGGTACTGCGGGTAACG
ACGACTGGCGTGCTCCACGCGAAGCTTAA
 Primer design