SecReT6
Protein ID: 543974110
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3979
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]979954..982032 [+]
Productputative VgrG protein
NoteTssI
UniProt IDU3A845
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-70, Aligned region: 26..332
Phage_GPD [PF05954], Evalue: 3.30E-70, Aligned region: 501..537
Phage_base_V [PF04717], Evalue: 5.20E-23, Aligned region: 371..463
Gp5_C [PF06715], Evalue: 2.00E-05, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 2.00E-05, Aligned region: 534..542
Gp5_C [PF06715], Evalue: 2.00E-05, Aligned region: 547..565
Gp5_C [PF06715], Evalue: 2.00E-05, Aligned region: 569..591
Gp5_C [PF06715], Evalue: 2.00E-05, Aligned region: 593..615
Gp5_C [PF06715], Evalue: 2.00E-05, Aligned region: 616..636
DUF2345 [PF10106], Evalue: 0.0092, Aligned region: 493..505
DUF2345 [PF10106], Evalue: 0.0092, Aligned region: 631..689
Protein Sequence: 692 a.a.     [Download]
>gi|543974110|ref|YP_008548856.1| putative VgrG protein [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MVNDVEFKFEVPGCGHEFRVESFHVHEELSKPFHINLSLLSLDPDISFDELIRKAGTLTLYGQGVGAARV
FNGVVNEVRYLGTGRRFSRYQLVLVPQAWFLSQRQDCRIFQQKSAQDIITEVLDDGTVTDYRFEVSGTYP
PKEYVLQYRESDLHFVQRMMAEHGMWYYFDHSDSNHTMVIVDSNDAIAPLISSPLNASYIGPIVYHADGG
GVADREHISDLELVNRVRTGQVTYTDYNYEHPKIPQEMTQAGELDQDLKQFDYPGRYVDPLMGQVRTTEW
MSEHIVDNQQVEATSDVMRLASGYSFNVSDHPRSEINRDYLMLSVMHTGQDPQVHEDEASGMPTTYYNQF
SCIPRDVVFKAPKLAAPVVDGPQTAVVVGPEGEEIYTDKLGRVKVQFHWDRYGDNNEHSSCWIRVSQSMA
APTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIHGHKTTQVNSTFTETVEQ
DVTVTYNANEAQYVKNNSDLEIGDNRTTKIGKNDDLDIGENSNLTIGASKSSDIGADDNQTVGGNLTVSV
KGNTAYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSAITIEGSDKVVVKGGNVVVN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|543973209|ref|NC_022359.1|:979954-982032 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGGTGAATGACGTAGAATTTAAATTTGAAGTGCCTGGATGTGGGCATGAATTTCGGGTTGAGAGCTTTC
ATGTTCATGAAGAGTTATCTAAGCCTTTCCACATCAATCTCTCATTACTTTCACTTGATCCAGATATCTC
GTTCGATGAGTTAATACGTAAAGCAGGAACATTGACACTTTACGGACAAGGTGTTGGGGCTGCGCGTGTG
TTCAACGGCGTGGTGAATGAAGTTCGTTACTTAGGGACTGGACGTCGTTTTTCTCGTTATCAATTAGTCT
TGGTTCCTCAAGCTTGGTTCTTATCTCAGCGCCAAGATTGTCGTATTTTCCAGCAAAAGTCAGCGCAAGA
CATCATCACAGAAGTACTCGATGATGGGACAGTCACCGATTACCGATTTGAAGTGTCGGGTACTTATCCT
CCAAAAGAATACGTTCTGCAATACCGTGAGTCTGACTTGCACTTCGTGCAGCGTATGATGGCTGAACACG
GTATGTGGTATTACTTTGACCATAGCGATTCAAATCATACGATGGTCATTGTCGACAGTAATGACGCGAT
TGCACCTTTGATAAGCTCGCCACTAAATGCTTCTTACATTGGGCCGATTGTTTATCATGCCGATGGTGGC
GGTGTTGCCGATCGCGAACATATCTCTGATCTCGAGTTAGTTAACCGCGTTAGAACGGGACAGGTTACGT
ACACAGATTACAACTACGAACACCCTAAAATTCCACAAGAGATGACACAGGCTGGCGAGCTAGACCAAGA
TCTCAAGCAGTTTGATTATCCTGGACGATACGTCGACCCGCTGATGGGTCAGGTGAGAACCACGGAGTGG
ATGTCGGAACACATAGTCGATAATCAACAAGTGGAAGCAACGAGTGACGTAATGCGCTTAGCATCTGGTT
ACAGCTTTAACGTCAGTGACCACCCGCGTTCTGAGATTAACCGCGATTACCTTATGTTGTCTGTAATGCA
CACAGGTCAAGATCCGCAAGTGCATGAAGATGAAGCGAGTGGTATGCCAACCACTTACTACAACCAGTTC
TCGTGTATTCCACGTGATGTGGTGTTTAAAGCGCCTAAACTAGCGGCACCAGTAGTGGATGGCCCTCAAA
CGGCGGTCGTTGTAGGACCAGAAGGTGAAGAGATTTACACCGACAAGCTTGGTCGAGTGAAAGTACAGTT
CCATTGGGATCGCTACGGTGATAACAACGAGCATTCAAGCTGTTGGATTCGTGTAAGCCAATCCATGGCG
GCGCCAACATGGGGCGCAGTTTATTTGCCGCGTATTGGCCATGAAGTCGTAGTGACTTTCCTTGAGGGGG
ACCCAGATCGTCCGTTAGTTACGGGCGCAGTTTACAACGGTTTGCATTTCCCACCGTACTCTTTGCCAGA
AAACAAAACTCGTACCACGTTCCGCACGCAAACGCACAAAGGAACAGGTTACAACGAGTTGAGTTTTGAA
GACGAAGCGAACCAAGAAGAAGTCTATATTCACGCTCAAAAAGACATGTCGACCAAGGTGCTCAACAACC
GTTACCGTGATATCGGTCAAGATGAATTCTTGAAAGTTGCACGTCACCAAACGAATGAAGTTCATGGTGA
CCATAAAGAAACCATTCATGGACATAAAACGACACAAGTAAACAGTACGTTTACCGAGACAGTCGAGCAA
GACGTTACCGTCACATACAACGCGAACGAAGCCCAGTATGTGAAAAACAATTCTGACTTAGAAATTGGTG
ATAACCGTACGACTAAGATCGGTAAAAATGATGACTTAGATATTGGCGAAAACAGTAACCTTACTATCGG
TGCGTCTAAGAGTTCAGATATTGGTGCGGATGATAACCAGACGGTTGGTGGCAACTTAACGGTATCAGTG
AAAGGGAACACCGCTTATAAAGCTGATGGTGCAACGCAAATTATCAGTGGCGACAAGATTGTATTGAAAA
CGGGTGGTTCCTCTTTAGTGATGAACAGTGATGGTTCAATAAAGTTATCAGGCTCGGCTATTACGATCGA
AGGCAGTGACAAAGTCGTCGTGAAAGGTGGCAACGTAGTGGTTAACTAA
 Primer design