SecReT6
Protein ID: 543974116
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3985
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]988066..989640 [+]
Producthypothetical protein
NoteTssA
UniProt IDU3BJT9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.10E-18, Aligned region: 48..108
Protein Sequence: 524 a.a.     [Download]
>gi|543974116|ref|YP_008548862.1| hypothetical protein N646_3985 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSNIDIDRLLNPISDESPVGNDARYEFCYEMMESEVKKFGSLFGETVDWSVVKTHATEVLEHHSKDLKAI
CYLVRALTEEFGLQGFEQGLKLLSEALSRFGVELYPSRKRGRDGAVEWLNHQFKLVSSKLAESAQSWDLV
SNCISTIEEVQRQYDEVYQDSEADFFEIRTQLNVLSQQAVADEQSYDAVVNVEQAAPAPATQPAAAETPA
QSEVQTAPVKAVPPAPKPAPVKKAVAKEVDVDTDFSSPTASKRTLKKVAEVMLHANPSDPLAYRIYRHLT
WDDIDGLPDHQNNQTPLSLAVSSDQQAEYRDKADQESDIDTIKRLERTLTDAPFWLTGHYFVYSMLNNLG
FDDAALAVKQEVTRFVESLEGIEHLSFKNSIPFADEATLSWLSTQDTTSSTSQPVVQTVVISQEDSLPME
DITLENLGECAAELAHKLELDSSGRGQFMLYLQLIAAYQSVGLYPLCLPYLEKGWEVQKAFNLANWEPHL
SSQLEDLIRKTLHRLFGSKDLLPEKYEEWKAIYD
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|543973209|ref|NC_022359.1|:988066-989640 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
TTGTCCAACATTGATATCGATCGTCTGCTTAATCCTATTTCTGATGAATCTCCAGTGGGAAACGATGCCC
GTTACGAGTTTTGCTACGAGATGATGGAATCTGAAGTAAAGAAATTCGGTTCCTTGTTTGGCGAAACAGT
AGATTGGAGCGTGGTAAAAACGCACGCGACTGAAGTTCTAGAGCACCACAGTAAAGACTTAAAAGCCATT
TGTTACCTCGTTCGCGCGCTAACAGAAGAGTTTGGTCTGCAAGGCTTTGAACAAGGTCTAAAGCTGCTTA
GTGAGGCGTTAAGTCGCTTTGGCGTTGAATTGTATCCTTCGCGAAAGCGGGGTCGAGATGGCGCGGTTGA
ATGGTTGAACCATCAGTTTAAACTGGTCAGTAGCAAGTTAGCGGAAAGCGCTCAGTCATGGGATTTGGTA
TCAAACTGCATTTCGACTATTGAAGAAGTGCAGCGCCAGTACGACGAGGTTTACCAAGACTCAGAAGCGG
ATTTCTTTGAGATTCGCACTCAACTCAATGTCTTATCTCAACAAGCGGTGGCTGATGAGCAGAGCTATGA
TGCAGTCGTTAACGTCGAACAAGCGGCGCCTGCACCAGCTACGCAGCCTGCTGCCGCAGAAACGCCAGCG
CAGAGTGAAGTGCAAACCGCACCGGTGAAGGCGGTTCCGCCGGCCCCTAAACCTGCGCCAGTTAAGAAAG
CGGTAGCAAAAGAAGTCGATGTCGATACGGACTTCTCTTCGCCTACGGCTTCTAAGCGCACCTTGAAGAA
GGTGGCGGAAGTCATGCTTCATGCGAACCCAAGTGATCCGCTGGCTTACCGGATTTATCGTCATCTGACT
TGGGATGACATTGATGGTCTACCCGACCACCAAAACAATCAAACGCCTTTGAGCTTGGCAGTGTCGTCCG
ATCAACAAGCGGAATACCGAGATAAAGCTGACCAAGAAAGCGACATCGACACGATTAAGCGTTTGGAGCG
CACATTAACGGATGCGCCGTTTTGGCTGACGGGCCATTACTTCGTGTATTCGATGCTTAATAACTTGGGC
TTTGATGATGCAGCGCTTGCTGTGAAACAAGAAGTGACGCGTTTTGTTGAATCGCTAGAGGGCATCGAGC
ACCTCTCATTTAAGAATTCTATACCATTTGCAGATGAAGCGACCTTGAGCTGGTTATCGACTCAAGATAC
TACTTCTTCGACTTCTCAACCCGTTGTTCAAACGGTTGTGATTTCGCAGGAAGACTCGCTGCCAATGGAG
GATATCACTCTAGAAAATCTAGGGGAATGTGCCGCAGAGCTTGCCCACAAACTTGAGCTGGATAGCTCGG
GACGTGGGCAGTTCATGCTGTATTTACAATTGATAGCAGCTTACCAGTCTGTTGGATTATACCCGTTGTG
TTTGCCGTATCTTGAGAAGGGGTGGGAAGTACAAAAAGCGTTTAATCTCGCGAACTGGGAACCCCACTTA
TCGTCACAGTTAGAAGACCTAATTCGAAAAACACTCCATCGGTTATTTGGAAGCAAGGATCTTCTACCTG
AGAAGTATGAAGAGTGGAAAGCAATTTACGACTAA
 Primer design