SecReT6
Protein ID: 543974117
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3986
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]989667..990173 [+]
Producthypothetical protein
NoteTssB
UniProt IDU3BTV6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-59, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|543974117|ref|YP_008548863.1| hypothetical protein N646_3986 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSRDGSVAPKERINIRYVPATGDTQEDVELPLSMMVVGDFTARADETPIEERTPINIDKDNFNEVLEGMS
PNVKVNVENRLSDEEGGQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELREALVALKGPLGNVPAFRKKI
ASVLQDEEARKKLLDELSIGNDQDAKEE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|543973209|ref|NC_022359.1|:989667-990173 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGTCACGTGACGGCTCGGTGGCTCCTAAAGAGCGAATTAATATCCGTTATGTTCCAGCAACTGGCGATA
CGCAAGAAGACGTAGAGCTGCCGCTAAGCATGATGGTAGTTGGCGACTTTACTGCGCGTGCAGATGAGAC
ACCAATTGAAGAACGTACTCCAATTAACATCGACAAAGACAACTTTAACGAAGTGCTAGAGGGCATGTCT
CCAAACGTTAAAGTCAACGTTGAAAACCGTCTTTCTGATGAAGAAGGCGGCCAGATAGGTGTTGATCTGA
CCTTCCAAAACATGAAGGACTTCTCTCCTGAAGCGATCGCGAAAAGTGTACCTGAACTAAACAGCCTACT
TGAGCTTCGCGAAGCCTTGGTTGCACTGAAAGGTCCTCTAGGAAACGTTCCTGCGTTCCGTAAGAAGATC
GCATCGGTTCTTCAAGATGAAGAAGCGAGAAAGAAACTGTTGGATGAACTAAGCATTGGCAACGACCAAG
ACGCGAAAGAAGAGTAA
 Primer design