SecReT6
Protein ID: 543974118
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3987
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]990182..991657 [+]
Producthypothetical protein
NoteTssC
UniProt IDU3A951
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-187, Aligned region: 66..490
Protein Sequence: 491 a.a.     [Download]
>gi|543974118|ref|YP_008548864.1| hypothetical protein N646_3987 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSAEAQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFISELLSSSNTEKVDQSLVDLMIS
EIDQKLSKQVDAILHNEEVQAIESTWRGLKYLVDHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDYAMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLK
DLKSVFEGPQYAKWRGLREHEDARYLGLCTSRFMLRTPYSVEDNPIKAFDYDEQVTDSHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGTVQDLPVYNFEAMGQIETKIPTEILVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
IELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
Q
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|543973209|ref|NC_022359.1|:990182-991657 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGTCTGCAGAAGCACAAGCGCCAGAACAAGAAGCAGCCTTAGTTGAATCAGGTTCACTTCTGGATAGCA
TTCTTAACGAAACACGTTTAAAGCCAAGTGATGAAGGTTTTGACGTTGCAAAGCGCGGCGTAGAAGCATT
CATCAGTGAGCTACTAAGCAGTTCGAACACAGAGAAAGTCGACCAATCTCTGGTTGATCTGATGATCTCT
GAAATCGACCAAAAATTGTCTAAGCAAGTTGATGCAATTCTTCACAACGAAGAAGTTCAAGCGATTGAAT
CAACGTGGCGTGGCCTTAAGTACCTGGTTGATCACACTGACTTCCGCGAGAACATTCAAATCGAACTGAT
CTCTGCGAAGAAAGACGAAGTTCTTGATGACTTCGAAGACGCGCCAGAGGTGGTGAAGTCTGGCCTGTAC
AAGCAGATCTACACACGTGAATACGGCCAGTTCGGTGGTAAACCTGTTGGCGCCGTCATTTGTGATTACG
CTATGTCAGCTTCGTCGCCTGACATCAAATTGATGGAATACATGGCTAACGTAGGTGCAATGTCTCACGC
ACCATTCATCACGTCGGCATCGGCTAAATTCTTTGGTCTAGACAGCTACGAAGAGCTGCCAAACCTAAAA
GATCTGAAGTCTGTATTCGAAGGTCCACAGTACGCGAAATGGCGTGGTCTGCGTGAGCACGAAGATGCGC
GCTACCTAGGTCTATGTACGTCTCGCTTTATGCTACGTACGCCTTACTCTGTTGAAGATAACCCAATCAA
GGCGTTTGACTACGATGAGCAAGTCACAGACAGCCATGATAACTACCTATGGGGCAACTCAGCGTACGCG
ATGGCGTCTAAGATCAGTGAATCATTTGCTAAGTACCGTTGGTGTCCGAACATTATTGGTCCTCAAAGCG
GTGGTACTGTACAAGATCTACCGGTTTACAACTTTGAAGCTATGGGTCAAATCGAGACTAAGATCCCAAC
CGAGATCCTGGTTTCTGACCGTCGTGAGTACGAGCTAGCGGAAGAAGGCTTCATTGCGCTAACCATGCGT
AAAGGTTCTGACAATGCGGCGTTCTTCTCTGCAAACTCTGTTCAAAAACCAAAAGTGTTTGCGAACACGC
CTGAAGGCAAACAAGCCGAGATGAACTACAAGCTAGGTACGCAGCTTCCTTACATGTTCATTATCAACCG
TTTAGCGCACTACATAAAAGTGCTACAGCGTGAGCAAATTGGTTCTTGGAAAGAGCGTTCTGACCTAGAA
ATCGAATTGAACAAGTGGATCCGTCAATACGTTTCTGACCAGGAGAACCCGCCAGCGGAAGTCCGTGGTC
GTCGTCCACTTCGCGCTGCGAAGGTAGAGGTATCAGACGTAGAAGGCGATCCAGGTTGGTACAAAGTATC
GATGTCTGTACGTCCTCACTTCAAGTACATGGGCGCAAGCTTCGACTTGTCTCTAGTTGGTAAGCTAGAC
CAATAA
 Primer design