SecReT6
Protein ID: 543974119
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3988
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]991719..992129 [+]
Producthypothetical protein
NoteTssE
UniProt IDU2ZQ35
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.00E-21, Aligned region: 24..116
Protein Sequence: 136 a.a.     [Download]
>gi|543974119|ref|YP_008548865.1| hypothetical protein N646_3988 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHSHLADLLNTHSGNAMIDNEYGLPDFNDVLSNNTNLV
RHIQKNITSTIERFEPRLLNVEVHYREDHHNPLQLGFGIRGEVSHNGGKVPMSIDVYMGTDGQFNV
 
Nucleotide Sequence: 411 bp     [Download]
>gi|543973209|ref|NC_022359.1|:991719-992129 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGGAAAAAGGTTACCGTCTTTTAGAGCGGATCGAGCTAGGAGAACCAAAAAACTGCTACGAGAAAGTGG
TGTCTCATAAGCATTTGATTGAATCCATTCACTCGCATCTCGCTGACTTGTTGAATACGCATTCCGGCAA
CGCAATGATCGACAATGAGTATGGTCTGCCAGATTTTAACGACGTACTTTCTAACAACACAAACCTCGTT
CGCCATATTCAAAAAAACATTACGTCAACCATAGAACGCTTTGAGCCCCGACTGCTTAATGTCGAGGTTC
ATTACCGTGAAGATCACCATAATCCATTACAACTCGGCTTTGGTATTCGCGGCGAAGTTTCCCATAACGG
CGGTAAAGTCCCAATGTCGATCGATGTCTACATGGGAACCGACGGCCAATTTAACGTTTAG
 Primer design