SecReT6
Protein ID: 543974120
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3989
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]992140..993888 [+]
Producthypothetical protein
NoteTssF
UniProt IDU3A835
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.70E-193, Aligned region: 5..582
Protein Sequence: 582 a.a.     [Download]
>gi|543974120|ref|YP_008548866.1| hypothetical protein N646_3989 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRIREKIDDELPELTQSL
MTLLWPHYMRSIPSLCISELKPHTGSVTEKTVVKRGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQT
NSRTSSMIDVTLSTEHGLELSRIGLDTLRLHLHGEIHITRTVFLWLFRYLDHVELDVGGGYKHRLGPEYV
KPVGHEEDEALLPYSKNSFAGYRLLQEFFSLPDKFMFFDIKGLEWLKGIPQRSTVKIKFHFKRALPSEVV
LKDKHLRLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQEHYEVYSIEQVESWSKDERRRKPLIEFE
SFEHQINQRDKREFYKSKVGERVSGRGLERYISFHTHNGDIADLGTETVLMKLQCSNADLAERLSVGDIT
YATHKSPTYATFKNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDFHSRVDRQAHR
ASIHRLDGIISSEMKPIDRVFRGVSVRGNQFKLVTDSKFFVNEGDMFLMATVLNEFIRLYSSVNSFTELE
VFDEATGEVYNWASLIGQQTIL
 
Nucleotide Sequence: 1749 bp     [Download]
>gi|543973209|ref|NC_022359.1|:992140-993888 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
TTGAGTAACAGTAAATACTTTCAAGATGAACTCACGTATTTACGCGAGTCGGGTAGTGAGTTTGCCAAAT
ATCATCCGAAGTTAACTCACTTTCTCTCTGAAGGAACTTTTGATCCAGATGTCGAACGATTGCTGGAGGG
TTTTGCTTTTTTGACCGGACGCATCCGCGAAAAGATTGACGATGAACTTCCTGAGCTAACGCAATCTCTG
ATGACTTTGCTGTGGCCACATTACATGCGTTCGATTCCGTCTTTGTGTATTAGCGAACTAAAACCGCATA
CCGGAAGTGTTACTGAGAAAACCGTGGTGAAACGTGGTGCGGAAATGGCCAGCGAGCAGGTAGAAGGCAC
GCAGTGTTTGTTCCGTACTTGTTATGACGTCAATCTATACCCAATTACGATTACTAACATCGAACAAACT
AACAGCCGCACCAGCTCGATGATTGATGTGACGTTATCGACGGAGCATGGCCTTGAGCTGTCTCGGATAG
GTTTAGACACGCTGCGATTGCACCTGCATGGTGAGATTCATATTACTCGCACTGTCTTCTTATGGCTGTT
CCGTTATCTAGATCACGTCGAGTTGGATGTTGGTGGCGGCTACAAACATCGTTTAGGGCCAGAATACGTT
AAGCCAGTCGGGCATGAAGAGGACGAGGCGCTGTTGCCTTACAGCAAAAATTCCTTTGCAGGCTACCGTT
TGCTGCAAGAATTCTTCTCTTTGCCAGATAAGTTCATGTTCTTCGACATTAAAGGCTTAGAGTGGCTAAA
AGGCATTCCACAGCGCAGTACGGTCAAAATCAAATTCCACTTTAAGCGTGCTTTGCCTTCAGAGGTGGTG
CTTAAAGATAAACACTTAAGGTTGCACTGCACACCTGCCGTCAACTTGTTTGAAAAAGACGGCGATCCAA
TCCGTTTAGAGCATCGACGAAACGAGTACAAGGTGCGTCCACAAAGTAACACTCAGGAGCATTACGAGGT
TTATTCCATTGAGCAAGTGGAGAGCTGGAGTAAAGACGAGCGTCGCCGAAAACCACTGATTGAATTTGAA
TCGTTTGAGCACCAAATCAACCAGCGTGATAAGCGAGAGTTCTACAAATCCAAAGTGGGTGAGCGAGTAA
GCGGAAGAGGGTTAGAGCGCTATATCTCATTCCATACTCACAATGGCGACATTGCGGATTTAGGGACTGA
AACAGTATTGATGAAACTGCAATGCAGTAACGCAGACTTAGCGGAGCGCCTGTCAGTAGGAGATATCACG
TACGCGACGCACAAATCGCCAACGTATGCGACGTTTAAAAACATTACTAAGCCAACACAGTCAGTAAGTC
CTCAGGTTAATGGTGAACTTCAATGGCAGTTGATTGCCAACATGTCGCTCAACTACTTGTCTTTGGCCAA
TATCGATGTGTTGAAAGTGTTGCTCTCGACTTACGACTTCCACTCTCGAGTCGATAGACAAGCCCACCGC
GCGTCGATTCATCGACTTGATGGCATTATTTCGTCAGAGATGAAACCAATCGATCGCGTATTTCGTGGTG
TATCTGTGCGTGGTAACCAATTCAAGCTCGTGACGGACTCTAAGTTCTTCGTAAATGAAGGCGATATGTT
CCTTATGGCCACGGTATTGAATGAATTTATCCGTTTGTATTCGAGTGTGAACTCCTTTACCGAACTAGAG
GTGTTCGATGAAGCGACGGGCGAGGTTTACAACTGGGCAAGCCTAATCGGGCAGCAGACGATACTATGA
 Primer design