SecReT6
Protein ID: 543974121
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3990
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]993885..994883 [+]
Producthypothetical protein
NoteTssG
UniProt IDU3BJT4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.30E-84, Aligned region: 8..317
Protein Sequence: 332 a.a.     [Download]
>gi|543974121|ref|YP_008548867.1| hypothetical protein N646_3990 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MINTLSDKSNEFSFYQAVLLLEKHYQLEPNSNFVAVGENKYFHQERIEFSVSPNLCFPKSDMDFITHMER
NGQQYSRIETNFLGLHGSSSPLPASYTEKLVGRDPDDNPVKDFFDFFHNRYTSLLYRVWKKYRYHVQYKS
GASDAFSGRILHLAGLSSVMQDCEVAELDRAKVLSYVNQLSTRTRSPKLISGIVSHYFSLPNVRIEEWVY
RRVEIAESQRNKLNRSNCILGQSLHLGQSIADLNGKFNLCIDNIDFETFKQFSYDGELHKTLVGLMRFIL
RDPMSWDLKLTVNLDSIPENKLGNGEGNQLGQTFWLGNPGDKDAKIRLIGSI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|543973209|ref|NC_022359.1|:993885-994883 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGATTAACACACTTTCTGATAAGTCGAATGAGTTTAGTTTCTACCAAGCGGTGTTGCTGTTAGAGAAAC
ACTACCAGCTGGAGCCAAACTCAAACTTTGTTGCCGTGGGCGAGAACAAATACTTCCACCAAGAACGAAT
TGAGTTCAGCGTGTCGCCAAACTTGTGCTTTCCAAAGAGTGATATGGATTTTATTACTCATATGGAAAGA
AACGGACAGCAATATTCACGTATTGAGACGAACTTTCTTGGCTTGCATGGTTCAAGCTCGCCCCTACCTG
CGTCTTACACTGAGAAACTCGTCGGTCGTGATCCCGATGATAACCCAGTGAAGGACTTCTTCGACTTTTT
CCACAACCGCTATACAAGCTTACTGTATCGTGTTTGGAAGAAATACCGATATCACGTGCAGTACAAAAGC
GGGGCGAGCGATGCGTTTTCTGGGCGCATACTGCATTTGGCTGGTCTGTCTAGCGTTATGCAAGATTGTG
AAGTAGCGGAGTTAGATCGAGCGAAAGTTCTGTCTTACGTGAACCAGTTATCTACGCGTACACGCTCACC
CAAGCTTATTTCCGGTATTGTTTCGCACTACTTTTCACTGCCGAATGTGCGAATCGAAGAATGGGTTTAT
CGGCGGGTCGAGATTGCAGAAAGCCAACGTAACAAACTCAACCGCTCCAATTGTATATTGGGGCAAAGCT
TACACTTGGGACAAAGCATTGCGGATTTGAACGGCAAGTTTAACTTGTGTATCGACAACATTGATTTTGA
AACGTTTAAGCAGTTTTCCTACGATGGTGAGTTACATAAGACGCTGGTGGGCTTGATGCGCTTTATTCTG
CGTGACCCAATGTCGTGGGACCTAAAGTTGACAGTTAACCTAGACAGTATTCCAGAAAACAAACTGGGTA
ATGGAGAAGGGAACCAACTAGGTCAAACGTTCTGGCTTGGCAACCCAGGTGATAAAGACGCCAAAATTCG
ACTTATCGGAAGCATATAA
 Primer design