SecReT6
Protein ID: 543974123
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3992
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]995422..998811 [-]
Productputative IcmF-related protein
NoteTssM
UniProt IDU3A947
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-52, Aligned region: 153..408
IcmF-related [PF06761], Evalue: 2.50E-48, Aligned region: 486..755
DUF1215 [PF06744], Evalue: 6.60E-32, Aligned region: 866..987
Protein Sequence: 1129 a.a.     [Download]
>gi|543974123|ref|YP_008548869.1| putative IcmF-related protein [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MFKQKLFRNPVVISTILMFLVAVIITTIYLLFLDEIDQLYLWLTLGAIAIVYVTFQFTLWLKKKNNAKAQ
HLETEEEALSMVIQPLLANSGKKPIYLMLGNKGSGRRQFLFNSSAIKPMDRTRTAKNDFFEWYESDSAVY
IKPDQRLVFQEVSSSDASLWNTFIEEVIHHRPRKPFSGCLFFTDFEFMIVSEPEQKEYTISSLLARLSTI
NSKTSSALPIYLIMSKLDKLDGFKEYMHFSSLKTRVEFLSIPLKEAKGVFAEYYRDSYRNLVRVLESNAL
DASANSTDIDEKQAILAFPKQFELCQSEVCYVLERLCDVNNGVYSLDIREIFFSSSLQGGRKYNLLAKSC
SNYFNLPIIASEHTQLTETPYFSRFLIDSQILPESDFAGENKTYLRLIQRQSRLAILGSIILLTGGSYFF
FTTLDSNLHVMNQLLSIDDKSQVEQDAKFNELLAKATKAIEPSYGAWLKGSKALDEEILPLNISRLGQST
RIAYEALLKDVAQQLIPLIEKGYRLQLTQNQNTFTRALPLLKGYLMLNDPTKRDIRFLRHQTLQMMNDLS
NQSDVVNQAMRYLDAYFRTQFDPIDINMDLVRATRRSLLANSNVDLVYAGILNEANSIDLGTLDLQRAVG
FEFSNVFNTPIDSERLIVDKIYTSTGFSTFYRPRVDLMSQQVISDNWVLGLSQHVIPTSEEQEAFKEEVR
KKYTDDYISNWRNALSELKVQNYDNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKNALISKLD
PKLVAAADSASDAVEEVVKPDYLLMKRVEQAFHLLNQLQVSETPNSPTPWDETVAALSRVRTYMKDIADA
PDPQMAALAAAQHRMNSSEADPLIKLKQIAQKSPEPVRSWLLDVVQQSWSVMIKESAKGIQTQWYSEIYT
KFKEIGLGRYPFDLTATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTNLWTPKQVDGETMPISPALLV
QLRNYNVIRDTLINKSTNRVHIPFSARVLDLDSSAIRASLKIADTNISYYHGPSRIREMAWPPQNGDFNI
SITLQDVTDEGRQHVLNKSGQWAIYRLLGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAEL
YNFTLPESI
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c998811-995422 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGTTCAAACAAAAACTGTTTAGAAATCCAGTGGTGATTTCTACTATATTGATGTTTTTAGTGGCTGTAA
TTATCACCACTATTTATCTGCTTTTTCTTGACGAAATCGATCAACTTTATCTTTGGCTGACCCTTGGTGC
TATCGCCATTGTTTACGTCACTTTTCAATTCACATTATGGTTGAAGAAAAAGAACAACGCTAAAGCTCAA
CATTTGGAAACCGAGGAAGAAGCACTTTCTATGGTTATCCAGCCTCTTCTTGCTAACTCAGGCAAGAAAC
CAATTTACCTGATGCTTGGTAATAAAGGGTCAGGGCGACGTCAATTTTTATTTAATTCTAGTGCAATCAA
ACCGATGGATCGCACTAGAACCGCTAAGAATGACTTTTTTGAATGGTACGAATCTGACAGCGCTGTATAC
ATCAAACCAGACCAACGCTTAGTGTTCCAGGAAGTATCAAGCAGTGATGCTTCTTTATGGAATACGTTCA
TTGAAGAAGTTATTCATCATCGACCTCGAAAGCCATTTTCTGGGTGTCTATTCTTCACCGATTTCGAGTT
CATGATCGTCTCTGAGCCAGAGCAAAAAGAGTACACCATTTCGTCGTTATTGGCGCGCTTGAGTACCATC
AACTCTAAAACGTCTTCAGCATTGCCAATCTATTTGATTATGTCAAAGCTAGACAAGTTAGATGGCTTTA
AAGAATACATGCACTTTAGCTCTCTCAAGACACGTGTTGAGTTCCTCTCTATCCCACTAAAAGAAGCCAA
AGGTGTATTTGCAGAGTACTACCGCGATAGCTATCGAAATCTAGTGAGAGTGCTTGAAAGTAATGCGCTA
GATGCATCCGCTAATTCAACGGACATTGATGAGAAACAAGCAATACTCGCTTTCCCTAAGCAGTTTGAGC
TATGTCAGTCTGAAGTCTGCTATGTGCTTGAGCGTCTATGTGATGTTAACAACGGTGTCTATTCACTAGA
CATCCGTGAGATTTTCTTTAGTTCGAGTCTGCAAGGCGGTCGCAAGTACAATTTACTTGCAAAAAGTTGT
AGTAATTACTTCAACTTACCTATTATCGCGTCAGAGCATACTCAGTTAACAGAAACGCCTTATTTCTCTC
GTTTTCTGATTGATTCACAAATATTGCCGGAAAGCGACTTTGCGGGCGAAAACAAGACGTATCTTCGTCT
AATTCAGAGGCAAAGCCGTTTGGCAATACTCGGCTCTATTATCCTGCTTACTGGGGGCAGTTACTTCTTT
TTCACGACATTAGACAGTAACTTACATGTGATGAATCAACTCTTGAGTATCGATGACAAATCACAAGTAG
AGCAAGATGCAAAATTCAATGAGCTTTTAGCGAAGGCGACGAAAGCAATAGAGCCTTCTTATGGGGCGTG
GCTTAAAGGTTCTAAGGCTTTGGATGAAGAGATATTACCACTCAACATTAGCCGTTTGGGTCAAAGCACT
CGCATCGCTTACGAAGCATTACTTAAGGACGTTGCTCAACAGTTGATACCTCTCATTGAGAAAGGTTACC
GTCTACAACTGACACAAAATCAAAACACTTTTACACGCGCTTTACCTCTATTGAAGGGGTATCTAATGCT
AAACGATCCAACAAAGCGTGATATCCGTTTTTTGCGTCATCAAACTCTCCAAATGATGAACGATTTGAGC
AACCAAAGTGACGTCGTCAATCAGGCGATGCGCTATTTGGACGCTTACTTTCGCACGCAGTTTGATCCAA
TTGATATCAATATGGATCTTGTTCGCGCAACACGTCGCTCATTGCTAGCAAATTCGAATGTTGATCTCGT
TTATGCAGGCATTTTAAACGAAGCAAATTCGATTGATTTAGGAACCCTAGATCTGCAACGAGCTGTGGGT
TTTGAGTTTAGCAATGTATTCAACACACCAATCGATAGTGAACGCTTGATCGTAGATAAGATCTATACCT
CCACTGGCTTTAGCACTTTTTATCGACCACGCGTGGACCTAATGTCACAACAAGTCATCAGTGACAACTG
GGTTTTAGGTCTGTCACAACACGTTATTCCTACTAGTGAAGAACAAGAAGCCTTCAAAGAGGAAGTACGT
AAAAAATATACTGACGACTACATCAGTAATTGGCGCAATGCGCTGAGTGAACTAAAAGTCCAGAACTATG
ACAATGTCGGCGATCTAACGAACGCGATAGACTTAATCTCGGGCCCTTCTTCACCAATGACAACCGTACT
GAAGCAGGTCTATGCCAACACACAATTTTCACCCGTTGGTGAAAAAAATGCTCTGATTTCAAAGCTAGAC
CCGAAACTCGTGGCAGCGGCAGACTCCGCATCAGACGCAGTAGAGGAAGTAGTTAAGCCTGATTACTTGT
TGATGAAACGTGTTGAACAAGCTTTTCACTTATTAAACCAACTTCAGGTCAGTGAAACACCAAACTCCCC
TACTCCTTGGGATGAGACCGTAGCTGCGTTAAGCCGTGTTCGCACATATATGAAAGACATAGCTGATGCA
CCTGACCCGCAAATGGCGGCGCTAGCGGCAGCTCAGCATCGAATGAACAGCAGTGAAGCTGACCCATTAA
TAAAACTTAAACAGATTGCCCAAAAATCACCGGAACCCGTTCGTAGCTGGTTGTTAGATGTGGTTCAACA
AAGCTGGTCAGTCATGATTAAAGAGTCCGCTAAAGGCATTCAAACCCAATGGTACAGCGAGATTTACACC
AAGTTTAAAGAGATAGGGCTGGGACGATACCCATTTGATCTAACAGCGACCGAGGAAATCTCAATTGAAG
ATTTTGAATTACTGTTTGCTTCAGGTGGCTTGTTAGACACATTTATTCAGAAAAATTTTGCACCGTTCTA
CGATACCAATTTGTGGACGCCAAAACAGGTGGATGGCGAGACGATGCCAATCTCTCCGGCTCTGTTAGTG
CAACTGCGTAACTATAACGTTATTCGAGACACATTAATTAATAAAAGCACTAACCGCGTTCATATTCCGT
TTAGTGCAAGAGTACTCGATCTTGATTCTAGTGCGATTAGAGCGAGCTTAAAAATTGCAGATACCAATAT
AAGTTACTACCACGGTCCAAGCCGCATTCGTGAAATGGCATGGCCACCGCAAAATGGTGACTTCAATATT
AGTATCACACTCCAGGATGTAACCGATGAAGGCAGACAGCACGTTTTAAATAAGAGTGGTCAATGGGCGA
TATACAGATTGCTAGGTGACTCGACCTTGACAAACACTCATAACGGCAGCTTTGTCAGTGACATAAAAGT
GTCAGGGAGGGACTTGAGCTTACGCATCACTCCGTTGACACAGAAAAACCCATTCACTCTTGCTGAGCTG
TATAACTTTACGCTCCCTGAGTCGATTTAA
 Primer design