SecReT6
Protein ID: 543974124
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3993
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]998839..1000152 [-]
Producthypothetical protein
NoteTssA
UniProt IDU2ZQ30
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-15, Aligned region: 46..104
Protein Sequence: 437 a.a.     [Download]
>gi|543974124|ref|YP_008548870.1| hypothetical protein N646_3993 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MFFTDFARRPIDENNPSGSNPNGSEDFDEIKRQINNLNKVTGRVSWKTVQTLSKKILSTQAKDLRCCCYF
TVASTYNDGLRGLVEGLNSILDVCVVYWFNAYPEHSKSKARMSAIEWMVEHTEKRINKHRALPEELPLIE
AAHQLCLRIEEELRLHYGIEAPSLGRIRRILNQWIEQIKEQQIAAELREKKQANTSAPAATQKAPEIKVN
VSPSPAPVSSPNLNSQEKASPAKSGRFMIYFVIGLIVTAICSHFMYEQQRYRTLEQKINQASLNELVNLV
ASLDYENKKYAQSLKTQAINRVDIMMNNWFLDSAKVSNVSELDSLTNELIAIYPDSSSAQQLRQNFLTQS
AHLEDQFMDVYKRFSDARTVFANVARQNVDKNSEKAYEYSNSLFPLLGRIEYAEKYSQQKEIDRATLLLN
IYLYKLSQLQAEKTDNK
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1000152-998839 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGTTTTTTACCGACTTCGCTCGAAGACCAATCGATGAAAATAACCCAAGCGGCTCTAATCCTAATGGTT
CTGAGGATTTTGACGAAATTAAACGTCAAATAAACAACCTGAATAAAGTCACAGGGAGAGTCTCGTGGAA
AACGGTTCAAACACTCTCAAAAAAGATCTTGAGTACCCAAGCGAAAGACCTACGTTGTTGCTGTTACTTT
ACCGTTGCATCAACCTATAACGACGGCTTAAGAGGCCTTGTTGAAGGGTTAAACTCAATACTTGATGTGT
GTGTCGTATATTGGTTCAACGCGTATCCAGAGCATTCAAAGTCAAAGGCACGAATGAGCGCTATTGAATG
GATGGTAGAGCATACTGAAAAACGAATTAATAAGCATCGGGCGTTACCAGAAGAGCTTCCATTGATAGAG
GCAGCACATCAATTATGCTTGAGGATTGAGGAAGAGCTTCGTCTTCATTACGGTATTGAAGCGCCGTCAT
TAGGTCGCATTCGCCGTATTTTGAATCAATGGATTGAGCAGATAAAAGAACAACAGATTGCGGCTGAGTT
ACGCGAGAAAAAACAAGCCAACACTAGCGCTCCTGCAGCAACGCAGAAGGCACCTGAAATTAAAGTGAAT
GTGTCTCCCTCTCCAGCACCGGTGTCATCACCCAACCTAAATAGCCAAGAGAAAGCATCACCGGCAAAGT
CTGGTCGATTTATGATCTACTTCGTTATTGGTTTGATTGTTACTGCGATATGTTCACATTTCATGTACGA
GCAACAACGTTATCGAACATTGGAACAAAAAATTAATCAAGCTTCACTTAATGAACTTGTAAATTTGGTC
GCCTCGTTAGATTACGAAAATAAAAAATATGCTCAGTCATTGAAAACGCAGGCCATTAATCGTGTCGATA
TTATGATGAATAACTGGTTTTTAGACTCGGCAAAAGTAAGTAACGTCAGCGAGCTCGATAGCTTGACCAA
TGAATTAATCGCGATCTATCCGGATTCGTCTTCTGCACAGCAACTACGTCAAAACTTTTTGACACAGAGC
GCCCATTTAGAAGACCAGTTTATGGATGTTTATAAGCGATTCTCAGACGCAAGAACGGTGTTTGCCAACG
TAGCTAGACAGAATGTAGATAAGAACTCTGAAAAGGCGTACGAATACAGTAACTCGTTATTCCCGCTTTT
AGGTCGTATTGAATACGCTGAAAAGTATTCACAGCAAAAGGAAATTGACCGCGCAACCCTTTTACTGAAC
ATCTACCTATATAAATTGAGTCAGCTACAAGCTGAAAAAACTGACAATAAATAA
 Primer design