SecReT6
Protein ID: 543974126
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3995
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1001265..1002758 [+]
Producthypothetical protein
NoteFha
UniProt IDU3BJS8
KEGG IDvag:N646_3995
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.00E-18, Aligned region: 31..97
FHA [PF00498], Evalue: 8.00E-18, Aligned region: 258..267
Protein Sequence: 497 a.a.     [Download]
>gi|543974126|ref|YP_008548872.1| hypothetical protein N646_3995 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MYSNQLVLFISKCPEEYTGAKHIEMPESGGSIGRSPSCSVSLADHNRFISGTHCLLSVYGDTYYISDVST
NGTMVNGNKILKNQPVAIVDGDIISLGQYEIGVSLEHVTSTLDIAADIAPERVSSDPLVSLGDAVVEEEE
KVGALEDLFMETKQDDIDCHDPVAHLNFSMQRDDDYLIRDNERTDSEQPRTVESTRQVVDDSFSIYSEFD
QPSLIPEDWMAAETKSNASVNDALAPESGKAHRADIASAEVMQPGTVAPDSTIQRQHRTHNVTEMVVEQA
NTGSKWEEMTQSFTPSPNTNQQLQIPTAEHAINSTTKAQVDTDAAVCSQDIAQAFFDGLGIRNPELMTNE
AQLFKQMGTCLRLCIDNLQKELHEVESLKDEQSASEANSNIAELMLTLNSQQLLAPNELVEQMLDELNDH
QVMFNKALNELILEQSETNDPVAFANRVASQSLFSTKSKLWAEYLDFYTNNRRLLNETSLKGLIKKNYNK
VIKGNHA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|543973209|ref|NC_022359.1|:1001265-1002758 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGTACTCAAATCAGCTAGTTTTATTTATCTCAAAGTGTCCAGAGGAATACACCGGTGCAAAGCATATTG
AAATGCCTGAAAGTGGTGGTTCGATAGGTCGTTCCCCAAGCTGTAGCGTGTCTTTAGCCGATCACAACCG
CTTTATATCGGGCACTCATTGTTTGCTCAGCGTGTATGGAGATACCTACTATATAAGTGACGTATCAACT
AACGGCACAATGGTAAATGGGAATAAAATACTAAAAAATCAACCCGTTGCGATAGTTGATGGCGACATCA
TTTCTTTAGGGCAATATGAGATTGGTGTTTCTCTTGAGCACGTTACCTCAACACTAGACATCGCCGCTGA
TATTGCTCCTGAGCGAGTATCTAGCGATCCTCTGGTTAGTCTAGGAGATGCGGTTGTCGAAGAGGAAGAA
AAAGTCGGTGCCTTAGAAGATTTGTTTATGGAGACTAAACAGGATGACATTGATTGTCATGATCCTGTTG
CTCACCTTAACTTTTCGATGCAGCGAGATGACGATTACTTAATTCGTGATAATGAGCGTACAGATTCTGA
ACAACCTAGAACCGTGGAAAGCACGCGTCAGGTGGTCGATGACAGTTTCAGCATATATTCCGAATTCGAT
CAGCCAAGCCTAATCCCTGAAGACTGGATGGCTGCGGAAACCAAGAGTAACGCATCAGTCAATGATGCAT
TAGCGCCAGAAAGCGGTAAGGCACATAGAGCCGATATTGCCTCAGCTGAGGTGATGCAACCTGGCACGGT
AGCCCCAGATAGCACGATTCAAAGACAACATCGTACGCATAATGTTACTGAGATGGTCGTAGAACAGGCT
AACACAGGGTCAAAATGGGAAGAGATGACCCAATCTTTTACGCCTTCTCCTAACACTAATCAGCAACTTC
AAATACCTACGGCAGAGCACGCGATAAACAGTACGACGAAAGCACAAGTCGATACTGATGCGGCCGTTTG
CTCTCAAGATATAGCGCAAGCGTTTTTTGATGGCTTGGGTATTCGAAACCCAGAGTTGATGACAAACGAG
GCGCAGTTATTCAAGCAAATGGGCACTTGCTTGCGTTTATGTATTGATAACCTACAGAAAGAGTTGCACG
AAGTGGAATCGTTAAAAGATGAGCAGAGTGCGAGTGAGGCTAACTCGAACATTGCAGAGCTAATGCTTAC
TTTGAATAGTCAGCAATTACTGGCTCCAAATGAACTGGTTGAACAAATGCTCGATGAGCTGAACGACCAC
CAAGTTATGTTTAACAAAGCACTGAATGAGCTCATTTTAGAACAGTCAGAAACGAACGATCCCGTAGCAT
TTGCTAACAGGGTCGCTAGCCAGTCTTTGTTCTCAACTAAGTCAAAGCTGTGGGCCGAATACCTAGATTT
CTACACTAATAATCGTCGCCTGCTTAATGAAACATCCTTAAAAGGGCTGATTAAGAAAAACTATAACAAA
GTGATTAAGGGAAACCATGCGTAG
 Primer design