SecReT6
Protein ID: 543974127
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3996
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1002751..1003251 [+]
Producthypothetical protein
NoteTssJ
UniProt IDU3BTV0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.50E-34, Aligned region: 11..152
Protein Sequence: 166 a.a.     [Download]
>gi|543974127|ref|YP_008548873.1| hypothetical protein N646_3996 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MRSIAVLLGFAMLSGCSMWDQFKESTGITPETSSIELVIEASPVLNVRNGGQSSPVILRLHELSSPVLFR
SLDFFALFESDKASLGDEYIKRYEYQIQPGGKVHEMLTLDPDTRAVGFSVAFRDIDGSSWRKVEVIEEKS
EYYIKLKLEGSELISDNTRGIEQVYF
 
Nucleotide Sequence: 501 bp     [Download]
>gi|543973209|ref|NC_022359.1|:1002751-1003251 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGCGTAGTATCGCCGTATTACTCGGATTTGCCATGTTGTCCGGTTGTTCCATGTGGGATCAATTTAAAG
AGTCCACTGGTATCACACCAGAAACTTCGTCGATTGAATTGGTTATTGAGGCATCACCTGTACTCAATGT
GAGAAATGGGGGCCAGTCATCTCCAGTTATTCTCCGTCTTCACGAATTAAGTTCGCCAGTATTGTTCCGA
AGCTTAGATTTCTTTGCCTTGTTTGAGAGCGATAAAGCGTCGTTGGGTGATGAGTACATCAAACGTTACG
AATATCAAATACAGCCAGGTGGAAAAGTTCATGAAATGCTAACTCTAGACCCTGACACTCGTGCCGTCGG
TTTTTCAGTGGCTTTTCGTGATATTGATGGTTCGTCTTGGCGAAAAGTGGAAGTTATTGAAGAGAAGAGC
GAGTACTACATCAAGCTCAAGTTAGAGGGCAGTGAGTTAATTTCTGATAACACTCGCGGCATTGAACAGG
TTTACTTTTAA
 Primer design