SecReT6
Protein ID: 543974128
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3997
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1003263..1004588 [+]
Producthypothetical protein
NoteTssK
UniProt IDU3A943
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-140, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|543974128|ref|YP_008548874.1| hypothetical protein N646_3997 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSLLSANASPLHWGIKRLEINSQLLALGKIGITRAEGILQ
DRTPFELPLLAELPEVKDVDPSIADKVVYLCCPLPSERSELFGTKKDGARYTMESQEAVDACYDSEDMAN
IVVGKLNFCLMYDHEDKSAYTSIPILKISEVKPDGSVILDDSFIPTCIDIHASTVLSKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFASTEAVHPESLYRILLQAEGELSTLCSTTRRP
IEFTKYNHGDLTSCLSRVLDSAKMTLSVMSEQRAIPLTLKDQNYGIRTAAIPDNKIIDTTTFILAVKADV
TLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAGYTYFELDKTGEEWMALKNTAA
IAIHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|543973209|ref|NC_022359.1|:1003263-1004588 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGTCTTTATACAATCCAGTTGTTTGGCAAGATGGAATGTTCATGAAGCCGCAGCATTTTCAACAACTCG
ATCGTTCGCAAAGTAAACTATCGAGCCTACTGAGTGCCAATGCATCGCCTTTGCATTGGGGAATTAAACG
TTTAGAAATCAACTCTCAGTTACTAGCACTGGGTAAAATCGGTATTACTCGTGCTGAAGGTATTTTACAA
GACCGGACACCATTTGAGCTTCCGTTGCTTGCCGAGTTGCCTGAAGTGAAAGATGTAGATCCTTCGATTG
CCGATAAAGTCGTTTATTTGTGCTGTCCGTTACCATCGGAACGCTCTGAGTTATTTGGTACCAAAAAAGA
CGGTGCGCGCTATACGATGGAATCTCAAGAAGCGGTTGACGCTTGTTATGATTCGGAAGACATGGCAAAT
ATCGTCGTCGGTAAGCTTAACTTTTGCTTAATGTACGATCATGAAGATAAGAGTGCTTACACGTCTATTC
CGATCTTAAAGATCTCAGAAGTGAAGCCTGATGGCAGCGTGATCTTAGATGATAGTTTCATTCCTACCTG
CATCGATATTCATGCGTCGACAGTACTGAGTAAATTTGCGACCGAGTTTGCTTCTATGTTGAAGCATCGC
GCGGAATCGATAGTTCAGCGATTAGGGGTGGTGGATCAACAAGGCGTATCATCGGTTTCTGACTTTATGC
TATTGCAAGCGCTCAACCGATACGAACCCTTGTTTTGGCATTTCGCAAGCACAGAAGCTGTGCATCCTGA
GTCTTTGTATCGAATTCTTCTTCAGGCAGAGGGTGAGCTTTCGACGCTGTGCTCAACGACACGCCGACCT
ATTGAGTTTACGAAGTACAATCATGGTGATCTTACTAGCTGTCTTTCTCGCGTCCTAGACAGTGCGAAAA
TGACATTGAGCGTGATGTCTGAGCAAAGAGCAATTCCACTGACCTTAAAAGATCAGAACTATGGCATCAG
AACGGCAGCAATCCCTGACAATAAGATCATTGATACGACAACCTTTATCCTCGCAGTTAAAGCCGACGTG
ACCTTGGATGTTCTGCATACCCAGTTTGTCAGCCAAACGAAGATCGGTTCTATCGATAACATACGTGACT
TGATTAACCTTCAACTGCCTGGGATTGAGATCAAACCAATGCCAGTTGTGCCACGCGCGCTGCCGTATCA
TGCTGGCTACACCTATTTCGAGCTCGATAAAACGGGCGAAGAGTGGATGGCGTTGAAGAACACTGCTGCG
ATTGCGATTCACGTTGCGGGCGATTTCGCTAACTTATCATTGCAACTTTGGGCCGTTCGTCTATGA
 Primer design