SecReT6
Protein ID: 543974129
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3998
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1004585..1005376 [+]
Producthypothetical protein
NoteTssL
UniProt IDU2ZQ27
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-54, Aligned region: 46..248
Protein Sequence: 263 a.a.     [Download]
>gi|543974129|ref|YP_008548875.1| hypothetical protein N646_3998 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLSIDNMGINPLVDQFSWLIASLSCMSSIPWLDD
PMPFREQVAREIRKGERKLNEMELDRASVLVIRYCLCAAIDESVCRQEWGANSHWSQNSLLSEFHNETSG
GDKFFVILDRLKADPRKYRHVIEFLYLLLQLGFQGKYGREERGNEKLAEIGSTIYRLVRDDRLAEQEKVS
LINLKAKYLKKPLKRVISPKLILSLSAMTFALMYAATYIVIDLKFQQLLEMYR
 
Nucleotide Sequence: 792 bp     [Download]
>gi|543973209|ref|NC_022359.1|:1004585-1005376 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGAGTTACGCAGAAACCGACGTCACCGTAGTCTTATTCCAACCAGAGCCTGGCAAACCAATGGAGGTAA
TGCCAGCGCCTGACTTGTCGAGAAACATCGCAGTACAAGATCTATCTATCGACAACATGGGTATTAACCC
GCTAGTGGACCAGTTCTCATGGTTGATCGCCAGTCTGTCTTGTATGTCTTCGATCCCTTGGCTTGATGAC
CCGATGCCATTTCGTGAACAAGTGGCACGTGAGATTCGAAAAGGTGAACGAAAACTTAATGAAATGGAGC
TCGATCGTGCTTCGGTTCTTGTTATTCGTTACTGCTTGTGTGCGGCGATTGATGAATCTGTTTGTCGACA
AGAGTGGGGGGCAAATAGTCACTGGAGCCAGAACAGCTTACTGTCTGAATTCCACAACGAGACATCTGGT
GGTGACAAGTTTTTCGTTATTCTCGACCGCTTAAAAGCCGACCCTCGCAAATACCGTCACGTTATAGAGT
TTCTCTATTTATTGCTTCAACTTGGTTTCCAAGGCAAGTACGGCCGTGAAGAGCGTGGCAACGAAAAGCT
AGCGGAAATTGGCAGCACCATTTATCGATTAGTGCGAGATGACCGCCTAGCAGAACAAGAAAAAGTTTCT
TTAATCAACCTTAAAGCTAAATATCTAAAGAAGCCGTTAAAAAGGGTAATTTCACCCAAGCTGATCTTAA
GTCTTAGTGCGATGACGTTTGCGCTTATGTATGCGGCAACCTACATCGTCATAGACTTAAAATTTCAGCA
ACTGCTTGAAATGTATAGATAA
 Primer design