SecReT6
Protein ID: 543974130
SecReT6 ID848
T6SS typei1
Gene symbol-
Locus tagN646_3999
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1005524..1006981 [+]
Producthypothetical protein
NotePAAR
UniProt IDU3A827
KEGG IDvag:N646_3999
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.10E-36, Aligned region: 19..128
Cna_B [PF05738], Evalue: 0.005, Aligned region: 138..149
Cna_B [PF05738], Evalue: 0.005, Aligned region: 163..214
Protein Sequence: 485 a.a.     [Download]
>gi|543974130|ref|YP_008548876.1| hypothetical protein N646_3999 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPVVPIPYGNNAKSADLAGGTTTVSMDGGNSVAIKG
STFSKSTGDAGGDRKGVSSGTIEAEAKFISASPTVKFEGKGVCRLSDQMTMNKANTMCLGGAQNPSVSVT
EEQEGTYTLDIECKYPNGLPYSNAKFSLVEPSGAVIGSGVLDSSGKASVNGLALKECRLVLSETQDSYTP
NQSLAENIVTETYPDPNDFCTFVAGRRSPFWEDRVGVANDWGILMSPSFSDDDFKDIVLEQSRISSPYAI
SQNHSKDFSDAYVSALYHIQTDTTALEKYEPLVELLLEQVHENGDILRVLYQADVFEPPYELLAKLRFLG
TGNTVKYLQFVLWTLINNQICSYIDELNSEIIGRLDFIQSQASARSLSSVEEGINGYKKALNHFKQALPD
VISQIFETKNDTLISISAMALGSTVNIASQSSFATNLGRVNAVVYTKSNNLNRPSFVTFDDNFSD
 
Nucleotide Sequence: 1458 bp     [Download]
>gi|543973209|ref|NC_022359.1|:1005524-1006981 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGGGCGTAACAGTTGGTGCGAATGGACTTTCGATAGTTCATAAAGGCTCAGGTGGTGAAGCGAATGCAA
CGCTCCCAGATGTTTGTTTAACTAAGGTCGGCAAGCCAGTCGTCCCTATCCCTTATGGCAACAATGCTAA
ATCAGCAGACCTTGCTGGTGGGACTACGACAGTCTCTATGGATGGCGGTAACAGTGTCGCTATCAAGGGC
AGTACGTTCTCAAAAAGTACCGGCGATGCGGGCGGTGACAGAAAAGGCGTTTCCTCAGGCACGATAGAAG
CCGAAGCAAAATTCATTTCAGCCTCACCAACAGTCAAGTTTGAAGGCAAGGGCGTATGTCGCCTGTCCGA
TCAAATGACCATGAACAAAGCCAACACTATGTGTTTGGGTGGCGCACAAAACCCATCGGTTTCTGTGACT
GAAGAGCAGGAAGGGACGTATACGCTGGATATAGAATGCAAATATCCAAATGGGCTCCCTTACTCTAATG
CAAAATTTTCTTTAGTCGAACCTTCAGGTGCTGTCATTGGGAGTGGAGTGCTGGACTCTAGCGGAAAAGC
ATCTGTTAATGGTCTCGCTCTAAAAGAATGCAGGTTAGTGCTCAGCGAAACTCAAGACTCTTACACCCCG
AACCAATCTTTAGCTGAAAATATTGTGACGGAAACTTACCCTGATCCGAATGATTTTTGTACGTTTGTCG
CAGGTCGCCGCTCACCATTTTGGGAAGATCGTGTTGGGGTTGCTAATGACTGGGGGATATTGATGTCCCC
ATCCTTCAGTGATGATGACTTTAAAGACATTGTGTTAGAGCAAAGCCGTATATCGTCTCCTTATGCGATT
AGTCAAAATCACTCTAAAGACTTTTCTGATGCTTATGTTTCGGCACTTTATCACATCCAAACTGATACTA
CTGCGCTAGAGAAATATGAACCTTTAGTTGAACTGCTCTTGGAGCAAGTGCACGAAAATGGCGATATATT
GAGAGTCTTATATCAAGCTGATGTGTTTGAGCCTCCCTATGAATTATTAGCGAAGCTTCGCTTTTTAGGG
ACTGGGAATACTGTGAAGTATTTGCAGTTTGTTTTATGGACGTTGATAAACAATCAAATCTGTTCATACA
TCGATGAGCTAAACAGTGAAATCATCGGTCGTTTAGATTTCATACAAAGCCAAGCTTCTGCAAGATCGTT
GAGTTCTGTTGAAGAGGGTATAAACGGTTATAAAAAAGCACTTAACCACTTCAAACAAGCACTTCCTGAC
GTCATTAGCCAAATTTTCGAAACCAAAAATGACACCCTAATTTCTATATCGGCAATGGCCCTTGGGAGTA
CCGTTAACATAGCGAGCCAATCTAGCTTTGCTACTAATTTAGGTAGGGTTAATGCGGTGGTGTACACGAA
GTCAAACAACTTGAACCGCCCATCATTTGTCACTTTTGACGATAACTTTTCTGACTAG
 Primer design