SecReT6
Protein ID: 543974541
SecReT6 ID849
T6SS typei5
Gene symbol-
Locus tagN646_4410
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]1452454..1455972 [-]
Producthypothetical protein
NoteTssM
UniProt IDU3AFF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.30E-87, Aligned region: 190..452
IcmF-related [PF06761], Evalue: 3.20E-86, Aligned region: 502..805
DUF1215 [PF06744], Evalue: 1.10E-38, Aligned region: 916..1034
AAA_19 [PF13245], Evalue: 0.006, Aligned region: 127..141
Protein Sequence: 1172 a.a.     [Download]
>gi|543974541|ref|YP_008549287.1| hypothetical protein N646_4410 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MRIKEIGRIFTQRWFLGLIGVAACSIFIWVVGPLIAIAGYEPLKSDFQRLVTILVLVLLWAIFNVTKQHK
QKVKEDESIQTLLEVDSLSDKEAASEIDLMRERIEQAVKVVTKTHKGKRSLYDLPWYVLIGPPGTGKTTV
LKQSGLEFPLGDSLGSDSIAGVGGTRHCDWWFANKAVLIDTAGRYTTQDSQEKVDSKAWHGFLGLLKKYR
TQRPINGAIVTISLASVMSQTRTERSLHARAIKSRLQELKNQLGMQFPIYVLLTKMDLVAGFNEFFADLS
KGEREELFGFMFPREVDDERGVISLFNKEFHGMLERLDARMLRILETEDDLDKRALIFEFPKQLRVLQAN
LDEFLAEIFAQNSFEEPALIRGVFMLSSVQEGLPVDKLMNESTNGLGLNRLALAKSQTGSHSYFVKNLFD
KVIFKEQLLGTVNRHYQKQSGWMRRGVYIGCTTLLLGASSLWFMSYKWNSQLIVDTNEQASHIDAMIGAQ
SLDFEADIVSAVETLDRLMTLPLGKQSDYGDADSVKRFGLYQGDKVSQAANNAYSDALTQYYAPLLLDSL
VSEMESNQQHREYLYETLKTYLMLFNPDKYQQDEVLAWFNFYFERQYPGELNADLRRRLLQHTQYLLGND
GQGFTYNTAAVTSAREVLTQMSLPERAYQRMKIQFSNSHVPSFRLTDVLGPKGLEQFERASGKPLSQGIS
GFYTYNGFHSIFQIQINRTVKSLMEENWVYGDDLKAHEIDQDSAIQGVQSRYYQDYVNEWKTLIEDIQLK
QAPSLELATEQARVLSGVERPIESLLRAIQKEVALSKVSLSENQKAASEVAGKVAKVKFSNTADRLDMYL
PEENGFNVALPGKEVESHFSEILRLGEQDFDDIQQAMVNLRSYLSDLSSSGNNQKIAYKSILDGTVTQDV
AASFARAKELLPRPFNQWLGELSQESVKFAESGSKDHLNQLWVTQVVRPYQRTIAGRYPFEPNASREVRL
KDFKRFFGYGGTLDAFFQEYLEPFVDTSKSRWRLEKEIGVRPETLMVFQRAQRIRQSFFESDNSLRVEFG
MKPVYLDQHITRFVLELGGQDLVYKHGPARAKSLSWPAGQDQTRIVFTPPESKREIAHTYEGEWGIFKLL
DQSLKARPESRKDNIVMIDLKGNKVQLELIPSSAINPFWSNEMERFRCPRTL
 
Nucleotide Sequence: 3519 bp     [Download]
>gi|543973209|ref|NC_022359.1|:c1455972-1452454 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
ATGCGTATTAAAGAAATTGGCAGAATATTTACTCAAAGATGGTTTCTCGGTCTTATCGGTGTCGCTGCTT
GTTCTATTTTCATTTGGGTTGTTGGTCCACTTATTGCGATAGCGGGATATGAGCCCCTAAAGAGTGACTT
TCAACGGCTAGTCACTATTCTAGTGTTGGTGTTGCTTTGGGCGATATTTAACGTTACCAAGCAGCATAAG
CAAAAGGTGAAAGAAGACGAAAGTATTCAAACGTTGCTTGAGGTTGATAGCCTATCAGATAAAGAAGCGG
CAAGTGAAATTGACTTAATGCGCGAGCGTATTGAGCAAGCTGTCAAAGTAGTGACGAAAACACACAAAGG
CAAGAGAAGCTTGTATGACTTACCGTGGTATGTGTTGATTGGCCCTCCTGGAACGGGGAAAACAACCGTA
TTAAAGCAGTCGGGGTTAGAGTTTCCATTAGGAGACAGCCTTGGCTCTGACTCTATTGCCGGTGTAGGTG
GCACTCGCCACTGTGATTGGTGGTTTGCAAATAAAGCAGTTCTTATAGATACGGCTGGCCGGTATACGAC
ACAAGACAGTCAAGAAAAGGTCGACTCTAAAGCGTGGCATGGTTTCTTAGGATTGTTGAAAAAGTATAGA
ACGCAAAGACCAATTAATGGTGCGATTGTTACGATAAGTTTAGCCAGCGTGATGTCTCAGACTCGAACCG
AGCGAAGTCTTCATGCTCGAGCAATTAAGTCGAGACTTCAAGAACTGAAAAACCAGTTAGGCATGCAGTT
TCCGATTTACGTATTGCTCACCAAAATGGATTTAGTTGCCGGTTTCAATGAGTTTTTTGCCGATTTAAGT
AAGGGAGAGCGAGAGGAATTATTTGGTTTCATGTTCCCTCGTGAAGTGGATGATGAAAGAGGCGTTATTT
CTCTATTCAACAAAGAATTTCATGGCATGTTGGAGCGCCTTGATGCCCGTATGCTTAGAATACTTGAAAC
AGAGGACGATTTAGATAAACGCGCGCTTATCTTTGAATTTCCAAAGCAATTAAGAGTGCTACAAGCTAAT
CTTGACGAGTTTTTAGCTGAAATTTTTGCACAAAACAGTTTTGAAGAGCCTGCCTTGATTCGTGGTGTGT
TTATGTTGAGTTCGGTTCAAGAAGGCTTACCAGTCGATAAGCTGATGAATGAATCAACCAATGGACTTGG
GTTAAATCGATTAGCTCTAGCAAAGAGTCAGACTGGTTCTCATAGTTATTTCGTAAAGAATCTTTTTGAC
AAGGTTATTTTCAAAGAGCAACTGTTAGGAACAGTTAATCGTCACTATCAAAAGCAGTCAGGTTGGATGC
GTCGAGGTGTTTACATTGGGTGTACAACGCTACTGCTCGGAGCTTCTTCGCTTTGGTTTATGAGTTATAA
GTGGAACTCACAGTTAATTGTCGACACCAATGAACAAGCTAGCCATATTGATGCAATGATTGGCGCTCAA
AGTTTAGATTTTGAAGCAGATATTGTTTCAGCTGTAGAAACATTAGATAGGTTGATGACGCTTCCTCTCG
GAAAGCAAAGCGACTACGGTGATGCCGACTCTGTAAAGAGGTTTGGTCTCTATCAGGGAGACAAAGTGTC
TCAGGCGGCAAATAATGCATATTCTGATGCTTTGACCCAATATTACGCCCCTCTGCTTCTTGATAGCTTG
GTGTCAGAAATGGAGAGCAATCAACAGCACCGTGAGTATTTGTACGAAACGTTAAAAACGTATTTGATGT
TATTCAATCCAGACAAATATCAACAAGATGAAGTGTTGGCTTGGTTTAACTTTTATTTCGAACGTCAATA
TCCGGGTGAGCTAAACGCAGACTTAAGAAGACGCTTGCTACAGCACACTCAATATTTATTAGGCAACGAT
GGACAAGGCTTTACTTACAACACTGCTGCTGTGACGAGTGCTCGAGAAGTGTTGACTCAAATGTCTCTAC
CTGAACGTGCTTATCAGCGAATGAAAATACAATTTTCTAATAGTCATGTACCTTCATTTCGCTTGACTGA
TGTATTGGGACCTAAAGGGCTTGAGCAGTTCGAGCGAGCTAGTGGAAAACCGCTATCACAAGGCATTTCG
GGTTTCTACACGTACAATGGTTTTCATAGCATTTTTCAGATTCAGATCAACCGTACAGTAAAAAGCCTAA
TGGAAGAGAACTGGGTTTATGGTGACGATCTTAAGGCCCATGAAATTGATCAAGATAGTGCCATCCAAGG
CGTTCAGTCTCGATACTATCAAGATTATGTTAATGAATGGAAAACGTTGATCGAAGATATTCAATTGAAG
CAGGCTCCGAGCCTAGAACTTGCGACAGAGCAAGCGAGGGTTTTATCTGGAGTTGAAAGACCAATCGAAT
CTTTGTTGAGAGCAATCCAAAAAGAGGTTGCTCTATCAAAAGTATCATTGTCAGAAAATCAAAAAGCCGC
TTCTGAAGTTGCTGGTAAAGTTGCCAAAGTTAAGTTTTCAAATACGGCAGATAGACTAGACATGTATTTA
CCTGAAGAAAACGGTTTCAATGTTGCTCTGCCAGGTAAAGAAGTCGAATCGCATTTTTCAGAGATCTTAC
GCCTTGGTGAGCAAGACTTTGATGATATTCAACAAGCAATGGTTAACTTGCGTTCGTATTTAAGTGACTT
ATCAAGCTCTGGTAACAATCAGAAAATTGCCTACAAAAGTATTTTAGATGGAACCGTTACACAAGATGTC
GCAGCTTCCTTTGCTCGTGCTAAAGAACTTTTGCCGAGACCATTTAATCAATGGCTAGGTGAGCTTTCTC
AAGAGTCGGTCAAGTTTGCGGAGAGCGGTTCGAAGGATCATCTAAATCAACTTTGGGTAACACAAGTGGT
GCGCCCTTATCAGCGGACTATTGCTGGCAGATATCCATTCGAGCCCAATGCGAGCAGAGAAGTCAGATTG
AAAGACTTTAAGCGATTCTTTGGTTATGGAGGCACGCTTGACGCATTCTTCCAAGAATACCTCGAACCGT
TTGTGGATACTTCGAAAAGTCGTTGGCGATTAGAAAAGGAAATTGGAGTTCGTCCAGAAACACTAATGGT
CTTTCAAAGAGCGCAACGTATCAGGCAGTCTTTCTTTGAATCTGATAATTCCTTACGCGTAGAGTTTGGG
ATGAAGCCTGTTTATCTAGACCAGCACATTACTCGATTTGTCTTAGAGTTGGGTGGACAAGATTTGGTTT
ATAAGCATGGACCAGCAAGAGCTAAATCGTTGAGTTGGCCTGCCGGTCAAGATCAGACTCGAATTGTGTT
CACACCACCTGAATCTAAACGCGAAATTGCGCATACCTATGAAGGTGAGTGGGGCATATTCAAGCTTTTG
GATCAATCACTTAAAGCAAGGCCAGAATCGCGTAAAGACAATATAGTTATGATTGATTTAAAGGGAAATA
AGGTGCAGCTAGAGCTTATTCCTTCTAGTGCCATTAATCCGTTTTGGTCAAATGAAATGGAGAGGTTCAG
ATGTCCACGAACCTTATAA
 Primer design