SecReT6
Protein ID: 544389063
SecReT6 ID850
T6SS typei1
Gene symbol-
Locus tagLY180_01100
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]247968..250775 [-]
Productprotein disaggregation chaperone
NoteTssH
UniProt IDT2FTW9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-38, Aligned region: 658..819
AAA [PF00004], Evalue: 8.70E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 8.70E-17, Aligned region: 664..781
AAA [PF00004], Evalue: 8.70E-17, Aligned region: 793..855
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 663..783
ClpB_D2-small [PF10431], Evalue: 1.30E-12, Aligned region: 825..902
AAA_16 [PF13191], Evalue: 4.70E-11, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 4.70E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 4.70E-11, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 4.70E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 4.70E-11, Aligned region: 634..704
AAA_16 [PF13191], Evalue: 4.70E-11, Aligned region: 729..757
AAA_22 [PF13401], Evalue: 2.50E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 2.50E-07, Aligned region: 447..482
AAA_22 [PF13401], Evalue: 2.50E-07, Aligned region: 662..697
AAA_29 [PF13555], Evalue: 4.80E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 4.80E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 4.80E-05, Aligned region: 661..688
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 658..692
AAA_25 [PF13481], Evalue: 5.50E-05, Aligned region: 791..855
NACHT [PF05729], Evalue: 8.50E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 8.50E-05, Aligned region: 283..345
NACHT [PF05729], Evalue: 8.50E-05, Aligned region: 453..453
NACHT [PF05729], Evalue: 8.50E-05, Aligned region: 664..692
NACHT [PF05729], Evalue: 8.50E-05, Aligned region: 870..893
AAA_14 [PF13173], Evalue: 9.30E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.30E-05, Aligned region: 663..753
AAA_19 [PF13245], Evalue: 0.00024, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00024, Aligned region: 657..685
DUF258 [PF03193], Evalue: 0.00034, Aligned region: 198..239
DUF258 [PF03193], Evalue: 0.00034, Aligned region: 664..682
AAA_18 [PF13238], Evalue: 0.0048, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0048, Aligned region: 664..699
Protein Sequence: 935 a.a.     [Download]
>gi|544389063|ref|YP_008563366.1| protein disaggregation chaperone [Escherichia coli LY180]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDAADTLLARYAKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGHVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESESESESESESESEQDNTGAEPADEAGSEQPE
ETAETVSPVQRLAHLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGD
TIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQ
EKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLID
CKNIVFFLTSNLGYQVIVEHADDPETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLAR
LDNVLRSRFGAEVIIEPEVTDEIMSRVTRAENGARMLESVIDGNMLPPLSLLLLQKMAANTAVARIRLSA
VDGAFTADVEDAQNDESVTKDETVL
 
Nucleotide Sequence: 2808 bp     [Download]
>gi|544388862|ref|NC_022364.1|:c250775-247968 Escherichia coli LY180, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTTAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCTGAATGTATGAGCCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTTATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
CTGACGGTGGAGAACTACACAACTGCCCGTTCTGCGGACAGCTACCCGGCATTTTCCCCGATGCTGGTTG
AGTGGCTGAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAATTGCGTGGCGGCGTGTT
GCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAATGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACACTGACGGACGCTGCTGACACCCTGCTTGCCCGCTACGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGCAAGAACAACCCGGTGGTGGTGGGCGAAGCAGGCGTGGGTAAAAGCGCCT
TAATCGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCATGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACTTGGGCGCATTGCAGGCCGGAGCGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCGGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGA
GCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATTGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTC
AGAGTCAGAGTCAGAGCAGGATAATACCGGTGCCGAACCGGCTGATGAAGCTGGCAGCGAACAGCCGGAA
GAGACCGCTGAAACAGTTTCCCCGGTACAACGTCTGGCACATCTCACTGCCGAACTGGACGCCCTGCATA
ACGACCGGTTGCTGGTTTCCCCGCACGTCGATAAAAAACAGATTGCGGCGGTGATTGCCGAATGGACCGG
CGTGCCGCTTAACCGCCTGTCGCAGAATGAAATGTCGGTCATCACCGACCTGCCAAAATGGCTCGGCGAC
ACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCACAAACACCTGCTGACCGCACGCGCCGACCTGC
GCCGTCCGGGACGCCCGCTGGGCGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGGGTAAAACTGAAACCGT
CCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCCGAGTTCCAG
GAGAAACATACCGTCTCGCGACTGATTGGTTCGCCTCCGGGCTACGTTGGCTACGGTGAAGGCGGCGTAC
TGACCGAAGCGATTCGCCAGAAACCCTACTCGGTAGTACTGCTCGATGAAGTGGAAAAAGCGCACCCGGA
TGTGCTCAACCTGTTCTACCAGGCGTTCGATAAGGGCGAAATGGCAGACGGTGAAGGCCGCCTGATTGAC
TGCAAAAATATCGTCTTCTTCCTGACGTCCAACCTCGGCTACCAGGTAATAGTCGAGCATGCCGATGACC
CGGAAACCATGCAGGAAGTACTGTATCCGGTGCTGGCCGACTTCTTCAAACCTGCCCTGCTGGCGCGTAT
GGAAGTGGTGCCGTACCTGCCGCTGTCGAAAGAGACGCTCGCCACCATCATTGCCGGGAAACTGGCCCGC
CTGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGAGGTGATTATAGAACCGGAAGTGACGGACGAAATCA
TGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTCATCGACGGCAATATGCTGCC
GCCGCTCTCCCTGCTGCTGTTGCAGAAAATGGCGGCGAATACGGCGGTTGCCCGGATTCGGTTGTCGGCA
GTGGACGGCGCATTTACGGCAGACGTGGAAGATGCTCAGAACGACGAGTCCGTCACAAAGGATGAAACGG
TTTTATGA
 Primer design