SecReT6
Protein ID: 544389064
SecReT6 ID850
T6SS typei1
Gene symbol-
Locus tagLY180_01105
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]250784..251545 [-]
Productmembrane protein
NoteTssL
UniProt IDT2FUN2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.10E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|544389064|ref|YP_008563367.1| membrane protein [Escherichia coli LY180]
MDEGSLSLPPFTGYDEKSQRDYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWLCFSLGFRGRYKVAAQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTIKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|544388862|ref|NC_022364.1|:c251545-250784 Escherichia coli LY180, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCAGCGCGACTATCATC
TCGCGCTTCGTGGCAACAGCCTGAATCCGATGATCGACGCGGCCACGCCGCTACTCGGTATGGTAATGCG
CCTTTCAACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACGGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAGCAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCGAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGAGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGCTCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGCACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGCCTGTACCACGTCCTGCATAAACT
ACGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACCATTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA
 Primer design