SecReT6
Protein ID: 544389066
SecReT6 ID850
T6SS typei1
Gene symbol-
Locus tagLY180_01115
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]252884..253408 [-]
Producthypothetical protein
NoteTssJ
UniProt IDT2FUF0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.00E-33, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|544389066|ref|YP_008563369.1| hypothetical protein LY180_01115 [Escherichia coli LY180]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLLAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPVKLDEKTQFIGVVAYFSDDQA
TEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|544388862|ref|NC_022364.1|:c253408-252884 Escherichia coli LY180, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGTGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACCGAACCGGACACCAATACCAATGCGGAAGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCTGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGGTAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGGCC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA
 Primer design