SecReT6
Protein ID: 544389067
SecReT6 ID850
T6SS typei1
Gene symbol-
Locus tagLY180_01120
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]253405..254685 [-]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDT2FUU5
KEGG IDecol:LY180_01120
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 426 a.a.     [Download]
>gi|544389067|ref|YP_008563370.1| type VI secretion system protein ImpI [Escherichia coli LY180]
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHGPECHWSVQDRQQSIPAQAFTVILHDGTFCLRP
QTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLST
EGTPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMD
LPPIYASPGDRNDDVSAAEMAQRHLAVTPLLRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKGLLDLQQQ
RNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRV
LLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|544388862|ref|NC_022364.1|:c254685-253405 Escherichia coli LY180, complete genome
ATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCAGTGAGCTGGAAAGCGGACGGG
CGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGGCCCCGAATGCCACTGGTCGGTACAGGA
TCGTCAGCAGAGCATTCCGGCCCAGGCTTTTACCGTTATCCTGCACGATGGCACATTTTGTCTGCGCCCG
CAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAGACCTAATACAGTTGCGCCAGG
GCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCGGGGAGATATTCCCCATTACGA
TGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTCACGGATACCCTGCTATCAACG
GAGGGTACGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAGACACCGTGGTAAACGGTTTTT
CTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGGCGATCCGCTTTCAGGCATTGC
GGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGGATCAATACTCCGTTTATGGAT
CTGCCGCCCATTTATGCCAGCCCCGGCGATCGTAATGACGACGTCTCTGCGGCAGAAATGGCGCAACGCC
ACCTTGCGGTCACCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCATGAGCAATTCCGACGATGCGGA
TGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGTCTGCTCGATTTGCAGCAGCAG
CGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAACATGGATTACG
CCACCGCGCTCGACGTAATGTTTGCCGAAGGTAAAAGCCCGGTACATCTGGCGGCTCCCGCCGCCGTCAG
TGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCAGCGATTGTGGAGTCGCTTCGTGTC
CTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGTACCGCCGCAGCCATGAACTGC
GCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTACGAAGAACTGGCCTCCGATCG
CCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAAGTCTATGACCGGGTGCTTCGTGAAAAA
CAGCGGGAGCCGGAAGCATGA
 Primer design