SecReT6
Protein ID: 544392783
SecReT6 ID850
T6SS typei1
Gene symbol-
Locus tagLY180_01125
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]254710..255792 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDT2G496
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.10E-93, Aligned region: 33..347
Protein Sequence: 360 a.a.     [Download]
>gi|544392783|ref|YP_008563371.1| type VI secretion protein [Escherichia coli LY180]
MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAELLHRLAKGEKGTPELSLRDDPAQETL
RFSADASLAFPCSDISALKRDTSGAFRMTTTFMGLQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSH
RLTQFVWHIWRKYRYHISFRNGGVDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEII
CGLVSHCFDLSEVTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSI
TSLTRKQFLSFLPSGENFLPLTMFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLGWTSFLGTPEE
RPSVTIRVRS
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|544388862|ref|NC_022364.1|:c255792-254710 Escherichia coli LY180, complete genome
ATGGACGGAAAGAATCGGGCAGCATCCTCTTATCTGAGTCCGGGAAATCCCCCGGCAGATAAAGAGCAGA
ATGATCCGCTGGCACAGGTTTTCCATAATGCCTGCTCTTACAATTTTTTTGCGATGGCGGAGCTGTTGCA
CCGCCTGGCAAAGGGTGAAAAGGGGACGCCAGAATTATCCCTGCGTGACGATCCGGCACAGGAAACCCTG
CGTTTCAGCGCCGATGCCAGCCTTGCCTTCCCGTGCAGTGATATCAGTGCGCTGAAACGGGATACATCAG
GGGCATTCAGGATGACCACCACCTTTATGGGGTTACAGGGGAGCCAGTCGCCTCTCCCCGGTTATTACCT
CGATCACCTGGCCTGGAAAGCGGTACATGAACAAAGTCCGGTAGGTGATTTTCTGGATATGTTCAGCCAC
CGCCTGACCCAGTTTGTCTGGCATATCTGGCGTAAGTACCGCTATCACATCAGTTTTCGTAACGGCGGTG
TGGATGCGTTCTCGCAGCGCATGTACTCCCTTGTCGGGCTGGGCCACCGCCAGCTTCGCGATAAGCTGGC
GATTAATCACAGCAAAATGCTGGCGTATTCCGGGATCCTGGCAAATCCGGGACGATCCCCGGAAATAATC
TGTGGCCTGGTGTCCCACTGCTTTGATTTGTCAGAAGTGACGCTGCAAAACTGGCAACGTCGCAAGGTGG
ATATTGAACCGGATCAGCAAAATAGTCTGGGGAGCTATTCTCTTAAAAATGGCGAAAAACTGGCGGGAAG
ATCGGTACTGGGCAACTTTGTTCTGGGTACACGAGTGCCCGATCTCAGCGGAAAATTCCAGCTCAGTATT
ACCAGCCTGACCCGAAAACAGTTCCTCTCTTTTCTGCCGTCCGGCGAAAACTTCCTGCCACTGACGATGT
TCGTGTCCTTCATCCTGCGCGATCAGCTTGCCTGGGACTTACATCTGGGGCTGGCGCCGGAGCAGGTGGG
CGCAATGCGCCTGGGCGATAACAAAAGTGCGCTGCTGGGCTGGACCAGCTTCCTCGGCACACCGGAAGAA
CGACCCTCAGTCACCATCAGGGTACGGTCGTAA
 Primer design