SecReT6
Protein ID: 544392786
SecReT6 ID850
T6SS typei1
Gene symbol-
Locus tagLY180_01145
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]259556..259780 [-]
Producthypothetical protein
NoteTssC
UniProt IDT2G543
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|544392786|ref|YP_008563375.1| hypothetical protein LY180_01145 [Escherichia coli LY180]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|544388862|ref|NC_022364.1|:c259780-259556 Escherichia coli LY180, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA
 Primer design