SecReT6
Protein ID: 544392787
SecReT6 ID850
T6SS typei1
Gene symbol-
Locus tagLY180_01170
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]263958..268007 [+]
Producttype IV secretion protein Rhs
NotePAAR
UniProt IDT2G5C6
KEGG IDecol:LY180_01170
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 229..243
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 325..361
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 352..384
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 434..472
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 459..492
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 498..537
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 542..577
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 584..620
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 626..661
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 667..697
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 701..718
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 729..762
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 784..806
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 823..834
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 852..860
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 875..906
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 955..992
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 1007..1018
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 1040..1053
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 1157..1175
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 1160..1186
RHS [PF03527], Evalue: 3.90E-20, Aligned region: 369..382
RHS [PF03527], Evalue: 3.90E-20, Aligned region: 624..635
RHS [PF03527], Evalue: 3.90E-20, Aligned region: 955..963
RHS [PF03527], Evalue: 3.90E-20, Aligned region: 1154..1194
Protein Sequence: 1349 a.a.     [Download]
>gi|544392787|ref|YP_008563380.1| type IV secretion protein Rhs [Escherichia coli LY180]
MGGKPAARQGDMTRKGLDIVQGSAGGLIGAPTGVACSVCPGGITYANPVNPLLGAKVLPGETDLALPGPL
PFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDSGGRSIHFEPLFPGEISYSRSESLW
LARGGVAAQHSSQPLSALWQVLPEDVRLSPHVYLATNSLQGPWWILSWPERVPGADEVLPPEPPAYRVLT
GVVDGFGRTLAFHRAAKGDVAGAVTGVTDGAGRRFHLALTTQAQRAEAFRKQRASSLSSPASPRSVSSSQ
VFPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDRSGTQVRGFAYDAE
HAGRMVAHHYAGRPESRYRYDDTGRVTEQVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYRLHMASGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPD
GLRSSREYDERGRLTAETSRSGETTRYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLAFTDCSGYTTR
YEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIIAPDGSRSETQYDAWG
KAISTTQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDE
GLITLWHYDASDRITRRTVNGEPAEQWQYDDHGWLTEISHLSEGHRVAVHYGYDDKGRLTGERQTVENPE
TGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSFGSM
AGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTLAPD
LDIRIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYHYDEYGRLTEKTDRIPAGVIRTDDERT
HHYHYDSQHRLVFHTRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRL
TTVQTQQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGRLERELRAG
AVSAESEAWLAQCGLTAEQMAAQMEDAYIPERRLHLYHCDHRGLPLALISPEGETAWCGEYDEWGNQLNE
ENPHHLYQPYRLPGQQHDEESGLYYNRNRYYDPLQGRYITQDPIGLEGGWNLYIYPLSPVMNIDPMGLSV
MAPALSMQNLSALLKSKMESTISSCNGESSGYLLTCQTAYDSDCGEIHERCMMLCKTAQIDPDMSHIWGG
SLFGCLNGCLPARCGGNAV
 
Nucleotide Sequence: 4050 bp     [Download]
>gi|544388862|ref|NC_022364.1|:263958-268007 Escherichia coli LY180, complete genome
ATGGGCGGAAAACCGGCGGCGCGGCAGGGTGATATGACCCGCAAGGGACTGGATATTGTGCAGGGTTCAG
CGGGGGGGCTGATAGGTGCGCCGACGGGAGTGGCCTGTTCGGTATGTCCGGGAGGGATTACCTATGCTAA
CCCGGTGAACCCGCTGCTGGGTGCGAAGGTGCTGCCGGGCGAGACGGACCTTGCGCTGCCCGGCCCGCTG
CCGTTTATTCTTTCCCGCGCCTACAGCAGCTACCGGACCAGAACACCCGCGCCGGTGGGGGTGTTTGGTC
CCGGCTGGAAAGCGCCCTTCGATATCCGCTTACAGATACGCGATGAAGGCCTGATACTCAACGACAGCGG
CGGCAGGAGCATTCACTTTGAGCCGCTGTTTCCCGGCGAGATAAGCTACAGCCGCAGCGAGTCACTCTGG
CTGGCGCGGGGCGGAGTAGCGGCGCAGCACAGTTCGCAGCCGCTAAGCGCGCTCTGGCAGGTGCTGCCGG
AAGATGTTCGCCTGAGTCCGCATGTGTACCTGGCGACAAACAGCCTTCAGGGGCCGTGGTGGATACTCAG
CTGGCCGGAGCGGGTGCCGGGGGCGGACGAGGTGCTGCCGCCGGAGCCGCCCGCATACCGGGTGCTGACG
GGCGTGGTGGACGGCTTCGGGCGGACGCTGGCCTTTCACCGGGCAGCTAAGGGTGACGTGGCGGGCGCGG
TGACGGGGGTGACGGACGGCGCGGGCCGCCGTTTTCACCTGGCGCTGACCACGCAGGCGCAGCGGGCGGA
AGCCTTCCGTAAACAGCGCGCCTCTTCCTTATCTTCCCCGGCCAGTCCCCGTTCTGTTTCCTCTTCTCAG
GTTTTCCCCGACACGCTGCCCGCCGGTACAGAGTACGGTGCCGATAACGGTATCCGGCTGGAGGCGGTAT
GGCTGACACACGACCCGGCATACCCGGATGAACAGCCGACTGCGCCGCTGGCGCGCTACACGTACACGGC
CGGTGGTGAACTGCGGGCGGTGTATGACCGCAGCGGAACGCAGGTGCGCGGGTTTGCTTATGATGCGGAG
CACGCCGGGCGGATGGTGGCGCACCATTATGCGGGGAGGCCGGAGAGCCGCTACCGGTATGATGATACCG
GCCGGGTGACGGAGCAGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGGCAGGACCGTGTGAC
CATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAGGGCGAGGGCGGCCTGAAGCGGGTGGTG
AAGAAGGAGCATGCCGACGGGAGCATCACCCGCAGCGAGTATGATGAGGCGGGGAGGCTGAAGGCGCAGA
CGGATGCGGCGGGGCGGCGGACGGAGTACCGGCTGCATATGGCGTCGGGCGCGGTGACAGCGGTGACGGG
GCCGGACGGCAGGACGGTGCGGTATGGCTATAACAGCCAGCGGCAGGTGACGTCAGTGACGTACCCGGAC
GGGCTTCGCAGCAGCCGGGAGTATGATGAGAGGGGAAGGCTGACGGCGGAGACCTCGCGCAGCGGTGAGA
CAACGCGGTACAGCTATGATGACCCGGCGAGTGAGCTGCCGACAGGGATACAGGACGCGACGGGCAGTAC
AAAACAGATGGCATGGAGCCGTTACGGTCAACTGCTGGCCTTCACGGACTGCTCGGGGTACACGACGCGG
TATGAGTACGACCGGTACGGTCAACAAATCGCCGTTCACCGGGAGGAAGGCATCAGCACTTACAGCAGTT
ATAACCCGCGTGGGCAACTGGTCAGTCAGAAGGATGCGCAGGGGCGGGAGACCCGTTATGAGTACAGTGC
CGCAGGCGACCTCACCGCTATCATTGCCCCGGACGGTAGCCGCAGTGAGACACAGTATGATGCGTGGGGT
AAAGCCATCAGCACCACGCAGGGCGGTCTGACGCGCAGCATGGGGTATGACGCTGCCGGGCGCATCACCG
TGCTGACCAACGAGAACGGCAGCCAGTCCACGTTCCGGTATGACCCGGTGGACAGGCTGACTGAACAGCG
CGGCTTTGACGGCCGGACGCAACGTTACCATTATGACCTGACCGGAAAACTCACGCAGAGTGAAGATGAG
GGGCTTATCACCCTCTGGCATTACGATGCGTCGGACCGTATCACCCGGCGCACGGTGAACGGTGAACCGG
CGGAGCAGTGGCAGTATGACGACCACGGCTGGCTGACAGAAATCAGCCACCTGAGTGAAGGCCACCGTGT
GGCGGTCCACTACGGCTATGACGATAAAGGCCGCCTGACGGGCGAACGGCAGACGGTGGAGAACCCGGAG
ACGGGGGAGATGCTGTGGGAGCATGAGACGGGGCATGCGTACAGCGAACAGGGGCTGGCGACCCGTCAGG
AGCCGGACGGTCTGCCGCCGGTGGAGTGGCTGACATATGGCAGCGGTTATCTTGCGGGGATGAAGCTGGG
CGGAACGCCGCTGGTCGAGTATACGCGGGACAGGCTGCACCGTGAGACGGTGCGCAGCTTCGGCAGCATG
GCAGGCAGTAATGCCGCATATGAACTGACCAGCACATACACCCCCGCAGGCCAGTTACAGAGCCAGCACC
TGAACAGCCTGGTGTATGACCGTGACTACGGGTGGAATGACAACGGCGACCTGGTGCGCATCAGCGGTCC
GCGACAGACGCGGGAATACGGCTACAGCGCCACGGGCAGGCTGGAGAGCGTGCGCACCCTCGCACCGGAC
CTGGACATCCGCATCCCGTATGCGACCGACCCGGCGGGAAACCGGCTGCCGGACCCGGAGCTACACCCGG
ACAGCACGCTCACGGCGTGGCCGGATAACCGCATCGCAGAGGATGCGCACTATGTTTACCACTATGATGA
ATACGGCAGACTGACGGAGAAGACGGACCGCATCCCGGCGGGTGTGATACGGACGGACGACGAGCGGACC
CACCACTACCACTACGACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCATGGCGAGCCGCAGG
TGGAGAGCCGCTATCTCTATGACCCGCTGGGCCGCCGGACGGGAAAACGGGTGTGGCGGCGGGAGCGTGA
CCTGACGGGGTGGATGTCGCTGTCGCGTAAACCGGAGGAGACCTGGTACGGGTGGGACGGTGACAGGCTG
ACCACTGTACAGACCCAACAGACAAGAATCCAGACGGTATACCAGCCGGGAAGCTTCACGCCGCTCCTGA
GAATCGAAACAGAGAATGGCGAACAGGCGAAGGCGCGGCACCGTAGCCTGGCGGAGGTGTTGCAGGAGGA
CACGGGTGTGACGCTACCGGCGGAGCTGGCGGTGATGCTGGGAAGGCTGGAGCGGGAACTGCGCGCGGGA
GCGGTGAGTGCGGAGAGTGAGGCATGGCTTGCGCAGTGCGGACTGACGGCGGAACAGATGGCCGCGCAGA
TGGAGGATGCATACATCCCGGAGCGGAGGCTGCATCTTTACCACTGCGACCACCGGGGACTGCCGCTGGC
GCTCATCAGCCCGGAAGGGGAAACGGCGTGGTGCGGAGAGTATGATGAGTGGGGCAACCAGCTTAATGAG
GAGAACCCGCATCACCTGTATCAGCCATACCGTCTGCCGGGGCAGCAGCATGATGAGGAGTCGGGGCTGT
ACTACAACCGGAACCGGTACTATGATCCGTTGCAGGGGAGGTATATCACCCAGGATCCCATTGGGCTGGA
GGGGGGATGGAATTTATACATTTATCCGTTGAGTCCGGTTATGAACATTGATCCGATGGGGCTATCTGTT
ATGGCTCCAGCATTGTCAATGCAAAACTTATCCGCATTACTTAAAAGTAAGATGGAATCGACAATTTCGT
CTTGTAACGGGGAATCATCTGGATATTTATTAACCTGCCAAACAGCATACGATAGTGACTGCGGAGAAAT
ACATGAGCGGTGTATGATGTTATGTAAAACTGCACAAATAGATCCAGATATGTCACACATTTGGGGCGGT
TCTCTTTTTGGGTGTCTAAATGGTTGTCTACCTGCTCGATGTGGTGGAAATGCCGTATAA
 Primer design