SecReT6
Protein ID: 544393092
SecReT6 ID851
T6SS typei2
Gene symbol-
Locus tagLY180_14385
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3025113..3028502 [+]
Producttype VI secretion protein VasK
NoteTssM
UniProt IDT2G689
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.30E-66, Aligned region: 412..729
IcmF-related [PF06761], Evalue: 3.30E-66, Aligned region: 792..833
DUF1215 [PF06744], Evalue: 1.30E-35, Aligned region: 446..479
DUF1215 [PF06744], Evalue: 1.30E-35, Aligned region: 852..971
Protein Sequence: 1129 a.a.     [Download]
>gi|544393092|ref|YP_008565944.1| type VI secretion protein VasK [Escherichia coli LY180]
MVPGLNRLRPRSVSGPAIVMTVAVVVALCTFIHRKPALLGVEPGSSQQMYWMAGVIAAGVVFLIIMGVYH
LLNRHAAVQNFELRRQLAAGDDYRAVTTKKADSRHPAMVELAAFLRDRYGPFWRRNVRLLLVTGEPEQAE
AIAPGLTGQHWLEGDHTVLIYGGRPSAEPDVTLLTALKKLRRSRPLDGIIWALTEEQSRQTAQLDKGWRE
LINGGKRLGFQAPLYLWQVCDNGDYQAGRPLQSVGCLLPERCTPEQLTAMLEAHTLPLTEQGMSQLLADN
RHDFLLRLAHTLAERGIAHWQSVLKPLLAGGAFSSLRLRGLMFSPPLTAVPEAAPHAWLPSQVWAGVTGD
NARGRAVGFPWLRAALMSAVCVLAIWGAGMTTSFFANCALVQETSIQTARALDTRLPQAEQLVALHTLQG
ELERLQYRIREGAPWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTA
TGEQRYKQLKALLMTSRPEKADAAFFSTTLMADSLRYENIPEGVRQSVFPSLLTFWMANLPEHPQWKTSP
PPELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAW
EGQVREAIEQVVTARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFTGSWLAFLNSIRWKKEDSL
SGILDQLTLMADARQSPLIALTDTLAWQAAAVRENRGLSDSLAKSAQELFNGKEKTPQQSREVDVPVGPL
DKTFAPLLRLLGDKAGGGGGDTQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTD
TRDYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQN
DASLPLLAQYLRDDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASG
DAGIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRG
SWSLIRLLEQAQVTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDA
EEYGEDADE
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3025113-3028502 Escherichia coli LY180, complete genome
GTGGTTCCGGGATTAAACCGTCTCCGGCCCCGTTCTGTTTCAGGGCCTGCCATCGTCATGACCGTGGCTG
TTGTGGTTGCGCTTTGCACGTTTATTCACCGTAAACCGGCATTGCTGGGCGTTGAACCGGGTAGCTCACA
GCAAATGTACTGGATGGCTGGCGTGATTGCCGCAGGCGTGGTCTTTTTGATTATCATGGGGGTTTATCAT
CTGCTGAACCGCCACGCTGCCGTACAAAACTTTGAACTCCGCAGACAACTTGCCGCCGGAGATGACTATC
GTGCGGTGACGACAAAGAAAGCCGACAGCCGTCATCCGGCAATGGTGGAACTCGCCGCCTTCCTGCGCGA
CCGCTACGGTCCGTTCTGGCGGCGTAACGTCCGCCTGCTGCTGGTGACCGGCGAGCCTGAACAGGCAGAA
GCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAGGGCGACCACACGGTGCTGATATATGGCGGCA
GGCCATCAGCGGAGCCTGATGTCACACTGCTGACCGCCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGA
CGGCATCATCTGGGCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCAACTCGACAAAGGCTGGCGCGAA
CTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCCCCACTCTATTTGTGGCAGGTCTGTGACAACGGTG
ATTATCAGGCCGGACGCCCCCTGCAAAGCGTCGGCTGCCTGCTGCCGGAACGCTGCACCCCGGAACAACT
GACCGCCATGCTGGAAGCTCACACCCTGCCGCTGACGGAACAGGGCATGTCGCAACTGCTGGCTGATAAC
CGCCATGATTTTCTGCTGCGTCTGGCCCATACCCTTGCAGAGCGGGGTATCGCTCACTGGCAAAGCGTCC
TGAAACCGCTGCTGGCAGGCGGCGCATTCTCTTCCCTGCGCCTGCGTGGTCTGATGTTCAGCCCGCCGCT
TACCGCCGTACCGGAGGCCGCACCTCATGCGTGGCTGCCGTCACAGGTCTGGGCGGGCGTGACCGGCGAT
AACGCACGGGGGCGTGCAGTGGGCTTTCCGTGGCTACGCGCCGCGCTGATGTCCGCTGTCTGCGTGCTGG
CAATATGGGGGGCCGGAATGACGACCTCTTTCTTCGCCAACTGCGCTCTTGTTCAGGAAACCAGCATCCA
GACTGCACGTGCGCTTGATACCCGCCTGCCGCAGGCAGAACAACTGGTGGCGCTGCATACCCTGCAGGGC
GAACTGGAGCGCCTGCAATATCGTATCCGCGAAGGTGCGCCGTGGTATCAGCGTTTTGGCCTTGAACGTA
ACCAACAACTGCTCGCAGCCGCCTTTCCCGGCTATGCGCAGGCGGCAAACCGGCTGGTGCGCGACGTGGC
CGTTGACCATCTGCAACAGCAACTGAACGCCTTTGTCGCCCTGCCGCCCAACAGTCCTCAGCGTACCGCC
ACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACTTCCCGCCCGGAAAAGGCCGACGCTG
CCTTTTTCAGTACCACGCTGATGGCAGACAGCCTGCGCTACGAGAATATCCCGGAAGGTGTGCGGCAGAG
CGTGTTTCCGTCACTGCTGACCTTCTGGATGGCGAACCTGCCGGAACACCCGCAGTGGAAAACCTCGCCG
CCACCGGAACTGACCGGCGCGGTGCGTAAAATCCTGCTGCGCCAGATTGGTGTGCGTAATGCCGAAAACA
CTCTCTACCAGAACGTACTGCAACAGGTGTCCCGCAACTACGCCGATATGACGCTGGCGGACATGACCGG
GGATACCCTCACCGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGGGATGTTCACCCGTCAGGCGTGG
GAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTGACGGCGCGGCGCGAGGAAATCGACTGGGTGCTCA
GCGACCGCCAGCAGGATACCTCTGCGGATATATCGCCGGATACGCTGCGTAACCGTCTCACCTCACGCTA
CTTTACCGACTTCACCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCGCTGGAAAAAGGAAGACTCGCTC
TCCGGCATTCTCGACCAGCTGACACTGATGGCCGATGCCCGTCAGTCGCCGCTGATTGCGCTGACCGATA
CCCTCGCGTGGCAGGCGGCGGCAGTCAGGGAAAACCGTGGCCTGTCAGACTCGCTGGCGAAATCGGCACA
GGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGTCGATGTGCCTGTCGGGCCGCTG
GATAAAACCTTTGCTCCGCTGCTGCGGTTGCTGGGCGATAAGGCCGGAGGCGGTGGTGGTGATACGCAAC
TCAGCCTGCAAACGTATCTGACCCGCGTCACCCGCGTACGCCTCAAACTGCAACAGGTGACCAACGCCCC
CGACCCGCAGGAAATGACGCAACAGCTGGCACAGACGGTACTGCAGGGCAAAACCGTTGACCTCACCGAC
ACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTGGGCGAGGAATGGAGTGGCTTCGGTCAGGCGCTGT
TCGTCCGCCCGGTGGAGCAGTCGTGGCGGCAGGTGCTGACGCCTGCGGCGGACAGCCTGAACCGCCAGTG
GCAGCGGGCGATTGTCAGCCACTGGAATCAGGACTTCGCTGGTCGCTACCCGTTCAAAGCCTCACAGAAC
GATGCCTCCCTCCCCCTGCTGGCGCAGTATCTGCGCGATGACGGGCGCATCAACCAGTTTATTGCCGCCA
ACCTTTCCGGCGTTCTGAAACGTGAAGGCCGCTACTGGGTGGCGGACGCCATGAACACGCAGGGGCTGAC
GGTCAACCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGACGTGGCTGACACCGCCTTTGCCAGCGGC
GATGCCGGAATACATTTTGAACTGCGGGCAAAACCGGCCCGAGACGTGATGAAGACACATCTGGTGATTG
ACGGGCAGGAACTGGAGTATTTCAACCAGAAAGAACGCTGGCAGCGTTTCAACTGGCCGGATGAACAGTG
GCAACCCGGCGCATCGCTGAGCTGGACCAGTACGCAGGCGATGGAACGCATACTGGCGGATTACCGGGGG
AGCTGGAGCCTTATTCGCCTGCTGGAACAGGCGCAGGTGACACCGGTGGACAGCAGCACCTTTAAAGTGG
TGTGGAAAGCGCAGGACGGCCTGCCGCTGAATTACCTGCTGCGGGTTGAACAGGGTAAAGGGCCGCTGGC
GCTGCTGGAACTGAAAAACTTCCGCCTGCCGGGACAGGTATTTCTGACCGGCAGGAGTATGAAAGATGCG
GAAGAATACGGGGAAGACGCCGATGAGTGA
 Primer design