SecReT6
Protein ID: 544574640
SecReT6 ID852
T6SS typei1
Gene symbol-
Locus tagECOPMV1_00228
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]245340..248867 [-]
Producthypothetical protein
NoteTssM
UniProt IDT2MLN6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.60E-83, Aligned region: 507..820
ImcF-related_N [PF14331], Evalue: 1.00E-59, Aligned region: 210..457
ImcF-related_N [PF14331], Evalue: 1.00E-59, Aligned region: 837..883
DUF1215 [PF06744], Evalue: 4.20E-32, Aligned region: 305..323
DUF1215 [PF06744], Evalue: 4.20E-32, Aligned region: 916..1034
Protein Sequence: 1175 a.a.     [Download]
>gi|544574640|ref|YP_008570164.1| hypothetical protein ECOPMV1_00228 [Escherichia coli PMV-1]
MFKFPTSRLFSTLKSALRPAMPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAV
WGLIALVWLTWRVMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYM
VIGPAGSGKSTLLREGFPSDIVYTPESIRGVEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRRLREH
WLGWLMQTRARQPLNGLILTLDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNG
FAALFHSLDKKDRDAILGVTFTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFS
RQMQGTGEIVTALLAALLDGENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTP
YFTRRLFPEVLLAEPNLAGENSVWLNSSRRRLTAFSTCGAALAALMVGSWHHYYNQNWQSGVNVLAQAKA
FMDVPPPQGTDEFGNLQLPLLNPVRDATLAYGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPS
LMNGLIRDLNIAPPESEEKLAVLRVVRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYAL
EHTDWHAQRQSSDSDAVSRWTPYDKPIINAQQELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFD
NVFVAGNDEKLVIPQFLTRYGLQSYFVKQREGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYIS
DYTATWRAGMDNLNVRDYEAMSALTDALEQIISGDQPFQRALTALRDNTHALTLSGKLDDKAREAAINEM
DYRLLSRLGHEFAPENSALEEQKDKASTLQAVYQQLTELHRYLLAIQNSPVPGKSALKAVQLRLDQNSSD
PIFATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPRATQDAS
LDSFERFFKPDGILDNFYKNNLRLFLENDLTFGDDGRVLIREDIRQQLDTAQKIRDIFFSQQNGLGAQFA
VETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGRAPRSIAFSGPWAQF
RLFGAGQLTNVTSDTFNVRFNVDGGAMVYQVHVDTEDNPFTGGLFSLFRLPDTLY
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|544574430|ref|NC_022370.1|:c248867-245340 Escherichia coli PMV-1 main chromosome, complete genome
GTGTTCAAATTTCCCACATCCCGACTGTTCAGCACGTTGAAATCTGCGCTCAGGCCAGCGATGCCGCGGT
TTAAAGTTTCCGCCACCTGGCTACTGACGCTGGCATGGATTTTTCTGCTGGTGTGGATCTGGTGGCAGGG
TCCAAAATGGACGCTCTATGAGCAGCACTGGCTGGCTCCGCTGGCAAACCGCTGGCTGGCGACCGCCGTC
TGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGGGTGATGAAGCGTCTGCAAAAGCTGGAAAAACAGC
AGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGCAATATCTGGA
TCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCCGTGGTATATG
GTCATTGGTCCTGCGGGTAGCGGCAAAAGCACGCTGCTGCGCGAGGGCTTTCCGTCTGACATTGTTTACA
CGCCGGAAAGCATCCGGGGTGTGGAATACCACCCGCTGATCACACCGCGAGTGGGCAACCAGGCGGTAAT
TTTCGATGTTGACGGCGTACTGACCACTCCCGGCGGGGATGATCTGCTCCGCCGCCGCCTGCGCGAACAC
TGGCTGGGCTGGCTGATGCAAACGCGCGCTCGCCAGCCGCTCAACGGTCTTATCCTGACGCTCGATCTTC
CCGATCTGCTGACGGCGGATAAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGCAACTTCAGGA
GATCCGTCAGAGCCTGCACTGCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCTGCTGAACGGC
TTTGCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACATTTACCCGCC
GCGCCCATGAAAGTGACGGCTGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTACAACAGGTGAA
CCTGGCGCTGTCGGATCTGGTGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCTGTGTTCAGCTTCTCC
CGTCAGATGCAGGGAACAGGAGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGTGAGAACATGG
ATGTAATGCTGCGTGGCGTCTGGCTCACATCCTCGCTACAGCGTGGCCAGGTGGATGATATTTTCACGCA
GTCCGCCGCCCGCCAGTACGGACTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGAGACGACGCCG
TATTTTACTCGCCGCCTCTTCCCGGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAAAACAGCGTCT
GGCTGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCACCTGTGGCGCGGCACTGGCGGCATTGATGGT
CGGAAGCTGGCACCATTATTACAATCAGAACTGGCAGTCTGGCGTTAACGTACTGGCACAAGCTAAAGCC
TTTATGGACGTACCACCACCGCAGGGAACGGATGAATTCGGCAATCTGCAATTGCCATTGCTTAACCCGG
TACGCGATGCCACCCTGGCCTATGGTGATTATCGCGATCACGGTTTTCTGGCGGATATGGGATTGTACCA
GGGCGCCCGCGTAGGGCCGTATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTATCTCCCCTCG
TTAATGAACGGCCTGATCCGGGATCTAAACATTGCCCCGCCAGAGAGCGAAGAAAAGCTCGCTGTGCTGC
GCGTAGTGCGCATGATGGAAGACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACATGGCACGGCG
CTGGAGCAATGAATTTCACGGCCAGCGCGATATTCAGGCGCAACTGATGGTGCATCTGGACTATGCGCTG
GAGCACACCGACTGGCACGCGCAGCGCCAAAGCAGCGACAGCGATGCTGTCAGCCGCTGGACCCCCTATG
ATAAACCGATCATTAATGCGCAGCAGGAACTGAGCAAGCTGCCCATATACCAGCGTGTCTACCAGACCCT
GCGCACCAAAGCATTAAGCGTGTTGCCCGCCGATTTGAATTTGCGCGACCAGGTTGGTCCCACCTTCGAC
AACGTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATCCCGCAGTTCCTCACCCGCTATGGACTGCAAA
GCTATTTTGTCAAACAGCGTGAGGGCCTCGTTGAGCTGACCGCGCTGGATTCGTGGGTACTGAACCTGAC
GCAAAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGATCCAGCGCCATATCACCGAACAGTACATCAGT
GACTATACCGCCACCTGGCGTGCCGGAATGGATAACCTCAACGTCCGTGACTATGAGGCCATGTCGGCGC
TGACCGACGCGCTGGAGCAGATTATCAGCGGCGATCAGCCATTCCAGCGTGCGCTGACGGCGCTGCGCGA
TAATACCCACGCGCTGACGCTCTCCGGCAAACTGGATGATAAGGCGAGGGAAGCGGCGATAAATGAGATG
GATTACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCACCGGAAAACAGCGCACTGGAGGAGCAAAAGG
ACAAGGCGAGTACGCTACAGGCCGTGTACCAGCAACTGACCGAGCTGCACCGTTACCTGCTGGCGATCCA
GAACTCGCCAGTGCCGGGGAAATCGGCGCTGAAAGCAGTACAGCTACGGCTGGATCAAAACAGCAGCGAT
CCAATCTTCGCCACCCGTCAGATGGCAAAAACCCTGCCTGCGCCTCTTAACCGCTGGGTAGGTAAGCTCG
CGGATCAGGCCTGGCATGTGGTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGCGCGACAATGT
AGTGAAACCCTTCAACGAGCAGCTTGCCGATAACTATCCGTTTAATCCGCGCGCCACACAGGATGCCTCA
CTGGATTCGTTTGAACGTTTCTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAACAACCTGCGCC
TGTTCCTTGAAAACGATCTGACCTTTGGCGACGACGGCAGAGTGTTAATCCGTGAAGATATCCGGCAGCA
ACTGGATACCGCGCAGAAAATCCGCGACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGCACAGTTTGCC
GTGGAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAGTTAGTGGACT
ACAGCCAGGGACGCAACTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAAGCAA
GCTGACGCTGATTGGCACCAGCGGCAGAGCACCGCGCAGTATCGCGTTCAGTGGACCGTGGGCGCAGTTC
CGCCTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTTAACGTGGACG
GCGGCGCAATGGTTTACCAGGTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTCTGTTCAGCCT
GTTCCGTTTACCGGATACGTTGTATTAA
 Primer design