SecReT6
Protein ID: 544574641
SecReT6 ID852
T6SS typei1
Gene symbol-
Locus tagECOPMV1_00229
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]248887..250329 [-]
Producthypothetical protein
NoteTssA
UniProt IDT2MM09
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 406..417
Protein Sequence: 480 a.a.     [Download]
>gi|544574641|ref|YP_008570165.1| hypothetical protein ECOPMV1_00229 [Escherichia coli PMV-1]
MAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSLAHSQLDIPELQRRGLMLLASET
KDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATI
QRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTSSARSAAIAPQATTGYVPDMSPH
TVAAQPPVAATPIPQVTVENHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESDGR
TPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQVADAIRDEVTDFL
ARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDENGLEAALRYLENLPEG
DPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLTAEQ
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|544574430|ref|NC_022370.1|:c250329-248887 Escherichia coli PMV-1 main chromosome, complete genome
ATGGCAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGC
TGTCCGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTC
ACTGGCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACC
AAAGATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCA
GGATGCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACG
CTTTGCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATA
CAGCGCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGC
TGGCAAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGAC
ATCATCTGCACGAAGCGCCGCCATTGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCAC
ACGGTTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAACCACGACGATA
AAGCATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGG
TTACCGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGG
ACCCCACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGG
CGCTGTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGC
ACAGACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTG
GCCCGCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAAC
AGTGGCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGC
GGCCAAGGCGTGCTTCGATGAAAACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGT
GATCCCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGC
TTGCACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTC
CCTGCTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA
 Primer design