SecReT6
Protein ID: 544574646
SecReT6 ID852
T6SS typei1
Gene symbol-
Locus tagECOPMV1_00234
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]255961..256485 [-]
Producthypothetical protein
NoteTssJ
UniProt IDT2MM14
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.40E-32, Aligned region: 14..167
Protein Sequence: 174 a.a.     [Download]
>gi|544574646|ref|YP_008570170.1| hypothetical protein ECOPMV1_00234 [Escherichia coli PMV-1]
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTADGEAAPVDVQ
LVYLSDDSKFHAADYDQVATTALPDVLGKNYIDHQDFNLLPDTVKTLPPIKLDEKTGYIGVIAYFSDDQA
TEWKQIESVESIGHHYRLLVHIRASAIEMKKEEN
 
Nucleotide Sequence: 525 bp     [Download]
>gi|544574430|ref|NC_022370.1|:c256485-255961 Escherichia coli PMV-1 main chromosome, complete genome
ATGAACGGCAAAGCGTTTCTGGCCTGCGTTCTGATGAGCGTCGTATTAACTGGCTGTGAAACAGCGAAAA
AAATCAGCCAGGTGATCCGCAATCCGGATATTCAGGTCGGAAAGCTGATGGATCAGTCAACCGAGCTGAC
CGTCACGCTGCTGACCGAGCCGGACAGCAACCTGACGGCGGATGGCGAAGCCGCGCCGGTGGATGTCCAG
TTGGTTTATCTGAGCGACGACTCAAAATTCCATGCCGCCGACTACGACCAGGTTGCCACCACCGCGCTGC
CCGACGTGCTGGGGAAAAACTATATCGATCACCAGGACTTCAACCTGTTGCCGGATACCGTAAAAACACT
GCCGCCGATCAAGTTGGATGAGAAAACCGGTTATATCGGTGTCATTGCCTATTTTTCAGACGACCAGGCC
ACAGAATGGAAACAAATTGAGTCGGTAGAAAGTATCGGCCACCACTATCGCCTGCTGGTGCATATCCGCG
CCAGTGCGATTGAGATGAAAAAAGAGGAAAACTGA
 Primer design