SecReT6
Protein ID: 544574647
SecReT6 ID852
T6SS typei1
Gene symbol-
Locus tagECOPMV1_00235
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]256482..257762 [-]
Producthypothetical protein
NoteFha
UniProt IDT2MMJ0
KEGG IDecoi:ECOPMV1_00235
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00096, Aligned region: 40..104
Protein Sequence: 426 a.a.     [Download]
>gi|544574647|ref|YP_008570171.1| hypothetical protein ECOPMV1_00235 [Escherichia coli PMV-1]
MAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIRHDGA
YCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDSLADT
LLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANGINTP
FMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLSLQQQ
QNSLSDKHLRPLEDNPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVEALRV
MLDAFSPGNLMRRFAQYRRSHELRQKMDDAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|544574430|ref|NC_022370.1|:c257762-256482 Escherichia coli PMV-1 main chromosome, complete genome
ATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATGGCAACGAACTGG
AAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATACGCCGGAATGTCA
CTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTACCGTTATCCGGCACGACGGAGCC
TATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCGATGCGCTCATCC
GCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCATGACGGTGCAGC
TGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGTCTGGCGGACACC
CTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTGCCCCCACGGTGG
CGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGCAGATGATCCGAT
CGCCCCACGCGTTTCCCGGCCCGTAGCCCCCGCATCCGATCTGACAGGTGCAAACGGGATCAACACGCCG
TTTATGGATCTGCCGCCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCATGGCGCAGTACC
ACCTGGCCGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTCTCAGGATGCGGA
TGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCATTAAGGGATTGCTGAGTCTGCAACAACAA
CAGAACAGCCTGTCGGATAAACACCTGCGTCCACTAGAAGACAACCCGTTGCGCCTTGATATGGACTATG
CCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGGTACATCTCGCAGCACCTGCGGCCATCGC
CGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCTAACCGGGCGGCGATTGTGGAAGCGTTGCGTGTC
ATGCTGGACGCCTTTTCGCCGGGCAACCTGATGCGCCGCTTTGCGCAATACCGCCGCAGCCATGAACTGC
GCCAGAAAATGGACGACGCCTGGGCATGGCAGATGTACAGCAACTATTACGATGAGCTGGCCTCCAGCCG
ACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCAGGTCTATGACCGGGTGCTGCGCGAAAAA
CAGCGGGAGCCGGAAGCATGA
 Primer design