SecReT6
Protein ID: 544574650
SecReT6 ID852
T6SS typei1
Gene symbol-
Locus tagECOPMV1_00238
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]260639..261064 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDT2MLP5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-20, Aligned region: 30..123
Protein Sequence: 141 a.a.     [Download]
>gi|544574650|ref|YP_008570174.1| type VI secretion system lysozyme-like protein [Escherichia coli PMV-1]
MLRRDSGPTGSLFERIREAANPPSYQNPKEALIRSIRRNLRQVLNTRSGSCYGSPELGITDLNDESLASS
DFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELCFHIVATVDVSETRGVFEFDILLDNHQRYCV
E
 
Nucleotide Sequence: 426 bp     [Download]
>gi|544574430|ref|NC_022370.1|:c261064-260639 Escherichia coli PMV-1 main chromosome, complete genome
ATGCTAAGACGGGATTCAGGACCAACCGGCAGTCTTTTTGAACGTATCCGTGAGGCGGCAAATCCGCCTT
CATATCAGAATCCAAAAGAAGCACTGATACGTTCCATCAGACGTAACCTGCGACAGGTCCTGAATACCCG
CTCCGGCAGTTGTTATGGTTCACCGGAGCTGGGGATTACTGATTTAAATGATGAATCGCTGGCCTCCAGC
GATTTCAGACGAGAAATCCGTAAGTCCATTAGCCAGTGCATTTTACATTACGAACCTCGTATTACCGATG
TTGTTGTTACGGCTGCTGCACCGGATGAATACGCCCCTGTGGAACTGTGTTTTCATATTGTGGCTACGGT
CGATGTCAGCGAAACCAGGGGAGTGTTTGAATTTGACATTTTGCTGGACAACCATCAACGCTATTGTGTG
GAGTGA
 Primer design