SecReT6
Protein ID: 544574652
SecReT6 ID852
T6SS typei1
Gene symbol-
Locus tagECOPMV1_00240
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]262576..263079 [-]
Producthypothetical protein
NoteTssB
UniProt IDT2MMJ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-48, Aligned region: 10..162
Protein Sequence: 167 a.a.     [Download]
>gi|544574652|ref|YP_008570176.1| hypothetical protein ECOPMV1_00240 [Escherichia coli PMV-1]
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIAINRYNLNAVI
SEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAF
RAQLQALLENEDTREQLIQELGIAVQK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|544574430|ref|NC_022370.1|:c263079-262576 Escherichia coli PMV-1 main chromosome, complete genome
ATGAGCAAAATGAACAACAATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAA
AAGTTGATGGGGTGGCTGCTGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAA
ACCAGATAACACGCCGTTGGATGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATT
TCAGAAGCTGACATTGAACGGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGT
ACGTCAACCTGAAAGTCAAATCTATGGATGACCTTTCTCCTGACCATATTGCCAGCCAGGTACCAGAAAT
AAAACGTCTGCTCGAATTGCGTGAAGCCCTAGTCGCACTTAAGTCTCCACTAGGCAATATTCCAGCCTTC
CGCGCACAACTTCAGGCGCTACTGGAAAACGAAGACACCCGCGAGCAGCTGATCCAGGAACTGGGTATCG
CCGTTCAGAAATAA
 Primer design