SecReT6
Protein ID: 544574655
SecReT6 ID852
T6SS typei1
Gene symbol-
Locus tagECOPMV1_00243
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]264524..266506 [+]
Producthypothetical protein
NoteTssI
UniProt IDT2MLP8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.90E-64, Aligned region: 34..328
Phage_base_V [PF04717], Evalue: 1.30E-26, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 6.10E-05, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 6.10E-05, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 6.10E-05, Aligned region: 546..563
Gp5_C [PF06715], Evalue: 6.10E-05, Aligned region: 567..584
Protein Sequence: 660 a.a.     [Download]
>gi|544574655|ref|YP_008570179.1| hypothetical protein ECOPMV1_00243 [Escherichia coli PMV-1]
MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKNATLTIWQGVIPLR
YVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRRNFRIFQQQDIRTISATLLNENGVTEWTPLFYEDH
PAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQKLTLCDDVAGLSQAGELPFNPDTSAGAETEC
VSMFRYEAHVRPSSVQSQDYTFKVPDWPGMYEQQGESLNGQLEQYEIFDYPGRYKDEQHGKDFTLYRMES
LRSDAEKATGQSNSPKLWPGTWFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIP
ADRTWRPRLQSKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYNPATEASSCWVRVSQAWAGPGF
GNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGFNELRFEDATG
GEQVYIHAQKNMDTEVLNNRTTDVKADHTETIGNDQKVTVGLGQTVNVGSKKEGGHDQKVTVANDQHLTI
KNDRHKVVNNNQTSKVTGTDTEEVVKKQSIKIGDNYELKVEHGTNIISGDSIELICGQGESGTCSIKLEK
TGKIIIRGTEFLFEATGPVDIKGKDIHLNG
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|544574430|ref|NC_022370.1|:264524-266506 Escherichia coli PMV-1 main chromosome, complete genome
ATGTCCTTAAAAGGTCTTCGCTTTACGCTGGAGGTTGACGGCCAGGAGCCGGACACCTTTGCAGTGGTGA
ATTTCCGGTTAATCCAGAACCAGTCTTATCCGTTTGTGATGAGTGTGGATGTCGCCAGCGATTCTTTTAT
GCAGACGGCGGAGATGCTGCTGGAGAAGAACGCAACGCTGACTATCTGGCAGGGTGTCATCCCGCTGCGT
TATGTCACCGGCGTGGTGGCGGGCTTTGGCATGCAGGAGAACAACGGCTGGCAGATGCGTTATCACCTGC
GTATTGAGCCGCCGTTATGGCGGTGCGGGCTGCGGCGGAACTTCCGTATCTTCCAGCAGCAGGATATCCG
GACGATATCGGCCACATTACTGAACGAGAACGGCGTCACAGAGTGGACGCCGCTGTTTTATGAGGACCAT
CCGGCGCGGGAGTTCTGTGTGCAGTACGGGGAGTCGGACCTGGCGTTTCTGGCGCGGCTGTGGGCGGAGG
AGGGGATTTTCTTCTTTGAGCGGTTTGCGGCGGACAGTCCGGAGCAGAAGCTGACGCTGTGCGACGATGT
GGCGGGGCTGTCACAGGCGGGGGAGCTTCCGTTTAACCCGGACACATCGGCAGGAGCGGAGACGGAGTGT
GTCAGTATGTTCCGTTATGAGGCGCATGTCCGCCCGTCATCGGTGCAGAGCCAGGATTACACGTTTAAGG
TGCCGGACTGGCCGGGGATGTATGAGCAGCAGGGTGAGAGCCTGAACGGACAGCTTGAACAGTATGAAAT
ATTTGATTATCCGGGAAGGTACAAGGATGAACAGCACGGCAAGGATTTCACGCTGTACCGGATGGAGAGC
CTGCGCAGTGATGCGGAAAAGGCCACAGGGCAGAGTAATTCGCCGAAGCTGTGGCCGGGGACGTGGTTTA
CGCTGACGGGGCATCCGCAGAAGATGCTGAACCGTGAATGGCAGGTGGTACAGAGCATTCTGTCAGGAGA
CCAGCCGCAGGCGCTTCACGGCAGCCAGGGGAGAGGAACCACGCTGGGAAATCAGTTAGAGGTGATACCG
GCGGACCGGACGTGGCGTCCACGGCTGCAAAGCAAACCGAAGGTGGACGGGCCACAGAGCGCCATTGTCA
CCGGGCCTGCGGGAGAGGAAATCTTCTGTGATGAACATGGCCGGGTACGGGTGAAGTTTCACTGGGACAG
GTATAACCCGGCAACGGAGGCGAGTTCGTGCTGGGTGAGGGTGTCACAGGCGTGGGCGGGGCCGGGGTTT
GGTAACCTGGCGATACCGCGCGTGGGCCAGGAGGTGATTGTTGACTTCCTGAACGGGGACCCGGACCAGC
CGATAATCATGGGGCGGACGTACCATGAGGACAACCGTTCGCCGGGGAGCCTGCCGGGGACGAAGACGCA
GATGACGATACGGTCGAAGACCTATAAAGGAAGCGGCTTTAATGAACTGCGGTTTGAAGACGCCACGGGC
GGTGAACAGGTCTATATCCACGCGCAGAAGAACATGGATACGGAGGTGCTGAATAATCGGACGACGGATG
TGAAGGCTGACCACACGGAGACCATTGGTAACGACCAGAAGGTAACGGTGGGGTTGGGCCAGACGGTGAA
TGTGGGGAGCAAAAAGGAAGGTGGTCATGACCAGAAAGTGACGGTAGCGAACGATCAGCATCTCACGATA
AAAAATGACCGGCACAAGGTTGTAAATAACAACCAGACAAGCAAGGTGACGGGAACTGATACCGAAGAAG
TCGTCAAAAAACAGAGTATTAAAATAGGTGATAATTACGAACTGAAAGTTGAGCATGGTACAAATATCAT
ATCTGGGGACAGTATTGAGCTAATTTGTGGGCAGGGAGAGAGCGGGACTTGTTCCATAAAACTGGAGAAA
ACAGGAAAGATAATAATACGGGGGACGGAGTTTCTATTTGAGGCTACCGGTCCTGTAGATATTAAAGGAA
AAGATATTCATCTGAACGGATAG
 Primer design