SecReT6
Protein ID: 544574657
SecReT6 ID852
T6SS typei1
Gene symbol-
Locus tagECOPMV1_00245
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]267652..269091 [+]
Producthypothetical protein
NotePAAR
UniProt IDT2MMJ9
KEGG IDecoi:ECOPMV1_00245
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.60E-23, Aligned region: 14..116
Peptidase_C39 [PF03412], Evalue: 4.90E-07, Aligned region: 352..474
PAAR_motif [PF05488], Evalue: 6.50E-05, Aligned region: 78..106
Peptidase_C39_2 [PF13529], Evalue: 0.00025, Aligned region: 354..391
Peptidase_C39_2 [PF13529], Evalue: 0.00025, Aligned region: 431..455
Protein Sequence: 479 a.a.     [Download]
>gi|544574657|ref|YP_008570181.1| hypothetical protein ECOPMV1_00245 [Escherichia coli PMV-1]
MGNYHIGDGECRFRVVCSSPDVCEVGGYKVPFDSYQTLDSERQYSSTVWARGCRALNVGSVIAGTQSNAG
KGVISGTSQGTGDCVILTGSPTVTIEGKPVAYHGSVVGINNHNCLGKLYTKIKSPMISVIDRTFNYERTA
EVIHDLLLLKDLLSVGNIFDGDISPEVKNDLFQIKDPDQSWGEFFSIKNIRESLRNGIEGDKSQIREWFG
ENTLTQMGNGAITTLHGVADLALVTFDALLDTATATVACPIGEDGLCEQANINLNEKEQALFNISNSLIN
GQAWDALKKMIMDTNNGDQIALEHFASFLWGFMIPAKIPEENISGKVFVEPVVLEGGAGGNWTVFDEVLD
SNVIKQLTLTGCGAACGEMLLRDRYIFVTQNVIGTELTSMTSLANKLNKFDVGWEGNAVSESSLYALSNT
GSWGAMMWDSGSKVGHWVLVKGVDDAGNVIIYDPYQGSRYLMTEQEFKEVWNGHSVYKP
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|544574430|ref|NC_022370.1|:267652-269091 Escherichia coli PMV-1 main chromosome, complete genome
ATGGGTAACTATCATATCGGGGATGGTGAATGTAGATTTAGAGTCGTGTGTTCTTCACCAGATGTATGTG
AAGTAGGAGGTTACAAGGTTCCTTTTGACAGTTACCAGACTTTAGATAGTGAAAGACAGTACAGTTCAAC
GGTATGGGCGCGTGGATGCAGAGCTTTAAATGTTGGTTCAGTGATTGCTGGAACTCAAAGTAATGCCGGT
AAAGGTGTCATATCCGGTACATCTCAAGGAACGGGTGACTGTGTTATTTTAACGGGAAGTCCGACTGTAA
CAATAGAAGGGAAACCTGTTGCTTATCATGGTTCAGTTGTTGGGATTAATAACCACAACTGCCTTGGTAA
ATTGTATACCAAAATAAAATCACCAATGATTTCTGTCATTGATAGAACTTTTAATTATGAAAGGACTGCT
GAAGTAATACACGATTTACTGCTTCTGAAGGATCTCCTCTCTGTTGGTAATATTTTTGACGGAGATATTT
CACCTGAGGTTAAAAATGATTTATTTCAAATAAAAGATCCTGACCAATCATGGGGGGAGTTTTTTTCAAT
AAAGAATATCAGAGAATCTCTCAGGAATGGTATTGAAGGAGATAAATCTCAGATCAGAGAATGGTTTGGA
GAGAACACACTTACTCAAATGGGGAATGGAGCAATCACCACTTTACATGGTGTGGCGGATTTAGCCTTAG
TTACATTCGATGCTCTGTTAGATACGGCAACGGCAACGGTTGCTTGCCCGATAGGCGAAGATGGGTTATG
TGAACAGGCAAATATAAATTTAAATGAAAAAGAACAGGCTTTATTTAATATTAGTAATTCATTGATAAAT
GGGCAAGCATGGGATGCACTTAAAAAAATGATAATGGATACAAATAATGGTGATCAGATTGCTCTGGAGC
ATTTTGCCAGCTTTTTATGGGGCTTTATGATACCCGCAAAAATACCAGAAGAAAATATCTCTGGGAAAGT
ATTTGTAGAGCCAGTAGTTTTAGAAGGTGGTGCTGGTGGCAATTGGACAGTATTTGATGAGGTTTTAGAT
TCAAATGTAATAAAGCAATTGACTTTAACAGGCTGTGGAGCGGCCTGTGGGGAAATGTTGCTTAGGGATA
GGTATATTTTTGTCACGCAAAATGTAATTGGAACAGAATTAACATCTATGACGTCGCTGGCAAACAAGCT
TAATAAATTTGATGTCGGCTGGGAAGGGAATGCAGTGAGCGAATCTAGTTTATATGCCCTCAGTAATACT
GGTTCATGGGGAGCAATGATGTGGGATTCTGGAAGTAAAGTAGGGCATTGGGTACTTGTTAAGGGTGTTG
ATGATGCTGGGAATGTGATAATATATGATCCATATCAAGGGAGTCGATATCTGATGACTGAACAGGAATT
TAAGGAGGTATGGAATGGGCATAGTGTTTACAAACCATAA
 Primer design