SecReT6
Protein ID: 544577332
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03075
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3144886..3145386 [+]
Producthypothetical protein
NoteTssB
UniProt IDT2MV85
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.40E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|544577332|ref|YP_008572856.1| hypothetical protein ECOPMV1_03075 [Escherichia coli PMV-1]
MADSFQNEVPTARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNFNSVMAEF
SPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3144886-3145386 Escherichia coli PMV-1 main chromosome, complete genome
ATGGCTGACAGTTTCCAGAATGAAGTTCCCACCGCTCGTGTAAATATCAAGCTTGATCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTCAACAGCGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTAATGAACAAAATATCGCGCTTG
AATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATATTCCGCAACTTCGTGTATTACT
CGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAACGCAACGTTTCGCCGTGAACTG
GAAAATATTCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA
 Primer design