SecReT6
Protein ID: 544577334
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03077
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3147001..3148338 [+]
Producthypothetical protein
NoteTssK
UniProt IDT2MVC1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|544577334|ref|YP_008572858.1| hypothetical protein ECOPMV1_03077 [Escherichia coli PMV-1]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDCIAQLCIRHPWGIANVLFDRDALTPGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLRALKNDSAIVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALDLASLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVQLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGSCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3147001-3148338 Escherichia coli PMV-1 main chromosome, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACTGTATTGCGCAGCTTTGTATTCGCCATCCGTGGGGGATCGCAAACGT
GCTCTTTGACCGGGATGCCCTGACGCCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCAGACGTGAGTGACGTTCTGCCGCTCGCCTGCGATCTGCGCGCGCTGAAGAACG
ACAGCGCGATTGTTTTGCTGGCGCTGCCGCTTGCACATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTGCGCTATCGTCAGGAATGGCAAAAGGTGCAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGCTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGGCTGGTACAGCGTCTGGACACATTGCTGTTGCAGCTACGGGCGAAG
TGCCAGCGTCTGATGGCGATGCGCCGGGAAAGCAACCAGCGTATGGCGGACTTTGCCGTCGCCGATGTCT
CCCTGTTCTGGCTGCTTAACGCGCTGAATTCCGCCGAGCCGGTGCTGAGCGATTTCCTGCGCTACCCGGC
TGTCCACCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGTGCGCTGCTGACGTTTTCCCTTGAG
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCACCGTCTTTCCGCCCCTGTTCTCCC
TGCTCAGCGAGCTGCTGGAAGCCAGCCTGCCGTCGCGGGTGATCGCGCTGGATCTGGCGTCCCTGCCGGG
CAACCGCTGGAAAGCCGACCTGCACGATCCGCGACTGCGGGAAGAGGCCGATTTTTATCTGTCCGTTCGT
TCCTCACTGCCTGCGCATCAGGTACTGCATCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCCGATGATG
TCACGCTGCTTATCAACGTGGCGCTGAACGGTGTTCAACTGGTGCCGCTTACCTCGGTTCCGGCGGCGCT
GCCGCTGCGGCTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGAGCTGCATGATTTATGCGCCGGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA
 Primer design