SecReT6
Protein ID: 544577335
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03078
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3148335..3149000 [+]
Producthypothetical protein
NoteTssL
UniProt IDT2MUA8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|544577335|ref|YP_008572859.1| hypothetical protein ECOPMV1_03078 [Escherichia coli PMV-1]
MKKDMDINIDALLRDTFLTVVELRQGTTVRHGIELYRHCQRQVELVRERLKDAGFSRENVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKNPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLALLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3148335-3149000 Escherichia coli PMV-1 main chromosome, complete genome
ATGAAAAAAGATATGGATATCAATATCGATGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATCGAGCTGTATCGCCACTGTCAGCGGCAGGTGGAACTGGTCCG
CGAACGTCTGAAAGATGCCGGATTCAGTCGGGAGAACGTGGAGCACATAACTTACGCGCAGTGCGCCCTG
CTGGACGAAACGGTGCTCAGCCGTAGTGGCATGGACGACGGTCAGGCCATCTGGATGAAAAACCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCCGGTGAGCTGCTGTACGAGCGGATGAAGCAGGTGCTACAGGA
ACCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCATT
TTTCTGGCTGGTAACACTGGCGCTGCTACTGGCGGGCGTCTGGTGGGGGCTACACCACTGGCTGAATGTA
CTGGTGGATGAACTGCTGCCGCAAAGCCTGCGTTAA
 Primer design