SecReT6
Protein ID: 544577336
SecReT6 ID853
T6SS typei2
Gene symbolyiaD_1
Locus tagECOPMV1_03079
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3149013..3150665 [+]
ProductInner membrane lipoprotein YiaD precursor
NoteTagL
UniProt IDT2MUV7
KEGG IDecoi:ECOPMV1_03079
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.30E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|544577336|ref|YP_008572860.1| Inner membrane lipoprotein YiaD precursor [Escherichia coli PMV-1]
MRNTLKQAIVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTGDAGLSSLPPE
TYRQPVVLVCGGLSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTLRPAWASQLAVAYTIMPGIHR
DVAVLAGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPERASSPWFICTGGEVQVATSTENAMPAQW
IAQSGVQERSQRLSYLLKAESLMQWLDLNVLAELNGPEAKCPPLAMAVGLVPSLPAVDNNLWQLWITART
GLTPDIADTGTDDALPFPDALLRRLPRQSGFTPLRRACVTMLGVTTVAGIAALCLSATANRQLLRQVGDD
LHRFYAVPVEEFITKARHLSVLKDDATMLDGYYREGEPLRLGLGLYPGERIRQPVLRAIRDWRPPEQKME
VTASLQVQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3149013-3150665 Escherichia coli PMV-1 main chromosome, complete genome
GTGAGGAACACGCTGAAACAGGCCATCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCAGTGT
TTATCAGTCCGTCTGGCGTGCTGAGATGGGCCGGTGCGGCGGCTATCGTTCTGGCGGTTGCTGCGTTGTT
GATTTATCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTCATCGCTGCCGCCGGAA
ACCTACCGACAGCCGGTAGTGCTGGTCTGTGGCGGTCTGTCGGCGCACCTGTTCACTGACAGCCCGGTCC
GCCAGGTTTCAGAAGGGCTGTATCTGCATGTTCCTGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGATT
GCTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCGTATACCATCATGCCCGGCATACACCGG
GATGTGGCGGTTCTGGCCGGACGGCTGCGACGGTTCGCCCACAGTATGGCGACGGTGCGTCGTCGGGCAG
GCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCGTTGCCGGAAAGAGCGAGTTCACC
GTGGTTTATCTGTACCGGCGGCGAAGTTCAGGTAGCAACATCCACAGAGAACGCGATGCCCGCGCAGTGG
ATTGCACAATCCGGCGTACAGGAACGCAGTCAGCGACTCTCTTATCTGCTGAAAGCCGAAAGCCTGATGC
AGTGGCTGGATCTTAATGTGCTGGCGGAACTGAACGGCCCGGAGGCGAAATGTCCACCACTGGCGATGGC
CGTGGGGCTGGTCCCCTCGTTGCCTGCGGTGGATAACAACCTGTGGCAGTTGTGGATCACCGCCAGAACC
GGCCTGACGCCGGATATCGCGGACACCGGCACAGACGATGCGCTGCCATTCCCGGATGCCCTGTTACGGC
GGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGGGCCTGCGTGACCATGCTGGGCGTCACCACCGT
GGCGGGTATCGCCGCGCTGTGCCTGTCAGCCACGGCAAATCGCCAGTTATTACGGCAGGTCGGTGACGAT
CTGCACCGGTTTTATGCCGTCCCGGTGGAGGAATTTATCACCAAAGCCCGTCACCTGTCGGTGCTGAAAG
ACGATGCGACCATGCTCGATGGGTATTACCGGGAAGGAGAACCACTGCGCCTCGGTCTGGGGTTATACCC
CGGCGAACGCATCCGCCAGCCGGTATTACGCGCCATTCGCGACTGGCGTCCGCCTGAACAAAAAATGGAG
GTGACGGCTTCGCTTCAGGTTCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGACGCACTGGTGAACATCCGGGCAAAACCGGGCTGGCT
GATCCTCGTGGCCGGATATACCGATGCCACCGGCGATGAAAAAAGCAATCAGCAGTTATCGCTGCGGCGT
GCCGAAGCGGTGCGCAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGCGAGAGCCAGCCTGCGGCGACCAACGACACGCCACAGGGCCGGGCAGTCAACCGGCGTGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA
 Primer design