SecReT6
Protein ID: 544577338
SecReT6 ID853
T6SS typei2
Gene symbolclpV1_2
Locus tagECOPMV1_03081
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3151406..3154051 [+]
Producthypothetical protein
NoteTssH
UniProt IDT2MUJ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 238..258
AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 609..774
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 22..57
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 240..352
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 614..738
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 762..779
AAA_5 [PF07728], Evalue: 1.90E-14, Aligned region: 240..264
AAA_5 [PF07728], Evalue: 1.90E-14, Aligned region: 337..370
AAA_5 [PF07728], Evalue: 1.90E-14, Aligned region: 613..732
ClpB_D2-small [PF10431], Evalue: 4.00E-14, Aligned region: 780..855
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 166..201
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 217..262
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 285..318
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 486..558
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 596..649
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 678..707
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 753..829
AAA_22 [PF13401], Evalue: 1.00E-08, Aligned region: 239..325
AAA_22 [PF13401], Evalue: 1.00E-08, Aligned region: 467..514
AAA_22 [PF13401], Evalue: 1.00E-08, Aligned region: 610..650
AAA_19 [PF13245], Evalue: 9.60E-08, Aligned region: 237..261
AAA_19 [PF13245], Evalue: 9.60E-08, Aligned region: 609..635
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 24..73
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 108..123
Arch_ATPase [PF01637], Evalue: 5.10E-07, Aligned region: 218..389
Arch_ATPase [PF01637], Evalue: 5.10E-07, Aligned region: 606..626
Arch_ATPase [PF01637], Evalue: 5.10E-07, Aligned region: 682..695
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 240..300
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 450..498
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 609..642
AAA_17 [PF13207], Evalue: 2.40E-06, Aligned region: 240..342
AAA_17 [PF13207], Evalue: 2.40E-06, Aligned region: 612..648
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 240..337
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 611..695
IstB_IS21 [PF01695], Evalue: 4.20E-06, Aligned region: 234..301
IstB_IS21 [PF01695], Evalue: 4.20E-06, Aligned region: 498..531
IstB_IS21 [PF01695], Evalue: 4.20E-06, Aligned region: 613..632
Zeta_toxin [PF06414], Evalue: 5.60E-06, Aligned region: 233..265
Zeta_toxin [PF06414], Evalue: 5.60E-06, Aligned region: 604..653
NACHT [PF05729], Evalue: 8.10E-06, Aligned region: 110..135
NACHT [PF05729], Evalue: 8.10E-06, Aligned region: 240..336
NACHT [PF05729], Evalue: 8.10E-06, Aligned region: 613..637
Sigma54_activat [PF00158], Evalue: 1.20E-05, Aligned region: 224..254
Sigma54_activat [PF00158], Evalue: 1.20E-05, Aligned region: 613..730
Sigma54_activat [PF00158], Evalue: 1.20E-05, Aligned region: 763..819
AAA_18 [PF13238], Evalue: 0.00024, Aligned region: 240..278
AAA_18 [PF13238], Evalue: 0.00024, Aligned region: 614..638
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 234..256
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 609..624
ResIII [PF04851], Evalue: 0.0021, Aligned region: 185..261
ResIII [PF04851], Evalue: 0.0021, Aligned region: 308..322
ResIII [PF04851], Evalue: 0.0021, Aligned region: 613..635
AAA_24 [PF13479], Evalue: 0.0021, Aligned region: 240..255
AAA_24 [PF13479], Evalue: 0.0021, Aligned region: 614..635
T2SE [PF00437], Evalue: 0.0025, Aligned region: 219..258
T2SE [PF00437], Evalue: 0.0025, Aligned region: 609..691
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 241..262
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 614..635
DUF2075 [PF09848], Evalue: 0.0052, Aligned region: 242..342
DUF2075 [PF09848], Evalue: 0.0052, Aligned region: 501..532
DUF2075 [PF09848], Evalue: 0.0052, Aligned region: 612..635
Protein Sequence: 881 a.a.     [Download]
>gi|544577338|ref|YP_008572862.1| hypothetical protein ECOPMV1_03081 [Escherichia coli PMV-1]
MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRYEWDIDTLWQS
LLAHLDTLPRSVRERPQLSEPLTALIRQAWLIASLEGDDPQIRSQHLLMALTEKSMLPACNDLWVLLSLS
RVQLERLRPLLDAQSDECPARQPQVTEPLTSALPETATADAPAKTLTEKQDDALLAVLNRFTEDVTEKAR
SGRIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRITEGNVPDSLKTVHIRTLDLG
LLQAGAGVKGEFEQRLKNVIDAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAA
TTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAQHHGVHMLDSAIQTAVRLSRRYLTG
RQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLHARLAALDIEREAIEQDSVFYPEASPERLAELTDLRDE
LQAEAGHLEAQYQQEKALAQQIMTLRQEGTDSTELQQQLRTHQGFAPLLALDVDARAVATVVADWTGIPL
SSLLRDEQSDLLSMEQSLENRVVGQRPALCAIAQRLRAAKTGLTPENGPQGVFLLTGPSGTGKTETALTL
ADTLFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVMN
LFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHIMQLLEEKPDATDADLHELLYPLLRDHFQPALMA
RFQTVIYRPLGQEAMRTIVEMKLAQVVRRLHQHYGLETEINDSLYDQLTAACLLPDTGARNIDSLLNQQI
LPVLSQQLLAQQAAHRKPAQLRLGWDEEDGIVLEFATEEMQ
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3151406-3154051 Escherichia coli PMV-1 main chromosome, complete genome
ATGACAGGAAATCACCCCGCCGCGCTGCTGCGTCGCCTTAACCCATACTGTGCACGGGCGCTGGACGCTG
CCGCCTCACTGTGTCAGACCCGCGCCCATGCGGAGATAACCATTGAACACTGGCTGCTGAAACTGCTGGA
GCAGGGAGAAGGCGATATCACGGTGATTGCCCGCCGCTATGAATGGGATATCGACACGCTCTGGCAGTCT
CTGCTGGCACATCTGGACACCTTACCCCGCTCGGTCCGCGAACGTCCGCAGCTTTCTGAACCCCTGACGG
CGCTTATCAGGCAGGCGTGGCTGATTGCCTCGCTGGAAGGCGACGACCCGCAAATCCGCAGTCAGCACCT
GCTGATGGCGCTGACAGAAAAATCGATGCTGCCCGCCTGTAATGACCTGTGGGTATTGCTGAGTCTGAGC
CGCGTGCAGCTTGAGCGGCTGCGTCCCCTGCTGGATGCGCAGTCGGATGAATGTCCGGCACGTCAGCCAC
AGGTCACCGAACCGCTGACCTCTGCACTGCCGGAGACGGCAACGGCGGACGCACCGGCAAAAACGCTGAC
GGAGAAACAGGATGACGCCCTGCTGGCGGTGCTTAACCGCTTTACCGAAGACGTGACGGAAAAAGCCCGC
AGCGGGCGAATCGACCCGGTATTCGGGCGCGACACGGAAATTCGCCAGATGGTCGATATCCTCTCCCGTC
GCCGCAAAAACAACCCGATTCTGGTGGGAGAACCGGGGGTGGGCAAAACCGCGCTGGTGGAAGGGCTGGC
GCTGCGTATCACCGAAGGCAACGTGCCGGACAGCCTGAAAACGGTGCATATCCGCACACTGGACCTCGGT
CTGTTACAGGCTGGCGCGGGCGTTAAAGGTGAATTTGAACAGCGGCTGAAAAATGTCATCGATGCAGTGC
AGAAATCACCGGAGCCGGTACTGCTGTTTATTGATGAAGCCCATACCATTATCGGTGCGGGTAATCAGGC
AGGCGGCGCGGATGCGGCGAACCTGCTGAAACCGGCACTGGCAAGGGGCGAACTGCGCACCATCGCGGCG
ACCACGTGGAGCGAATACAAACAGTATTTTGAGCGCGACGCCGCGCTGGAGCGCCGCTTCCAGATGGTTA
AGGTTGACGAGCCGGATGATGACACCGCCTGTCTGATGCTGCGGGGACTGAAGGCTCGCTATGCACAGCA
CCACGGCGTGCATATGCTGGACAGCGCCATTCAGACCGCCGTGCGCCTGTCGCGCCGCTATCTGACCGGA
CGCCAGCTGCCGGACAAGGCGGTTGATTTGCTGGATACCGCCGGGGCAAGAGTCCGCATGAGCCTTGACA
CCCTGCCGGAACCGTTGACGCAGCTTCATGCGCGACTGGCGGCACTGGATATTGAGCGGGAAGCGATTGA
GCAGGACAGCGTATTTTATCCCGAAGCCAGCCCGGAGCGGCTGGCGGAACTGACCGATTTGCGTGATGAG
CTACAGGCAGAAGCCGGGCATCTGGAAGCGCAGTATCAGCAGGAAAAGGCACTGGCGCAGCAGATTATGA
CGTTGCGTCAGGAAGGAACAGACAGCACTGAACTGCAACAGCAACTGCGAACGCATCAGGGCTTTGCACC
GCTGCTGGCGCTGGATGTGGACGCCCGCGCCGTCGCTACGGTGGTGGCGGACTGGACCGGCATCCCGCTC
TCATCCCTGCTCAGGGACGAGCAGAGCGATCTGCTCAGTATGGAACAGAGCCTTGAAAACCGCGTGGTCG
GGCAACGCCCGGCGCTCTGCGCCATCGCACAGCGGCTGCGGGCGGCTAAAACCGGCCTCACGCCGGAGAA
CGGCCCACAGGGGGTATTCCTGCTGACCGGCCCCAGCGGCACCGGCAAAACCGAAACTGCGCTCACACTG
GCCGACACCCTGTTTGGTGGTGAAAAATCCCTTATCACCATTAATCTTTCGGAATACCAGGAACCGCATA
CCGTTTCCCAGTTGAAAGGTTCGCCTCCGGGCTATGTCGGCTACGGTCAGGGCGGCGTACTTACCGAAGC
CGTTCGCAAACGCCCTTACAGCGTGGTGCTGCTCGACGAAGTGGAAAAGGCGCATCGCGACGTGATGAAC
CTGTTCTATCAGGTGTTCGACCGGGGCTTTATGCGCGACGGCGAAGGGCGGGAAATCGACTTCCGCAACA
CCGTCATTCTGATGACCGCCAATCTGGGCAGCGACCACATCATGCAGCTGCTGGAGGAAAAACCGGACGC
CACGGACGCAGACCTGCATGAACTGCTGTATCCCCTTCTGCGAGACCATTTTCAGCCTGCACTGATGGCG
CGTTTTCAGACGGTGATTTACCGCCCGCTGGGACAGGAAGCGATGCGCACCATTGTGGAAATGAAACTGG
CGCAGGTGGTCCGCCGTCTTCACCAGCACTACGGACTGGAAACGGAAATCAACGACAGCCTGTATGACCA
GCTTACCGCCGCCTGCCTGCTGCCGGACACCGGTGCGCGTAATATCGACAGCCTGCTGAACCAGCAAATC
CTGCCGGTCTTAAGCCAGCAGTTGCTGGCACAGCAGGCCGCGCACCGTAAACCAGCCCAACTACGGCTTG
GCTGGGATGAGGAGGACGGGATTGTACTGGAGTTCGCTACGGAAGAGATGCAATAA
 Primer design