SecReT6
Protein ID: 544577339
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03082
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3154063..3156543 [+]
Producthypothetical protein
NoteTssI
UniProt IDT2MVC7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-63, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 7.60E-49, Aligned region: 602..751
T6SS_Vgr [PF13296], Evalue: 5.90E-37, Aligned region: 480..584
T6SS_Vgr [PF13296], Evalue: 5.90E-37, Aligned region: 596..615
T6SS_Vgr [PF13296], Evalue: 5.90E-37, Aligned region: 782..815
Phage_base_V [PF04717], Evalue: 3.60E-14, Aligned region: 392..473
Protein Sequence: 826 a.a.     [Download]
>gi|544577339|ref|YP_008572863.1| hypothetical protein ECOPMV1_03082 [Escherichia coli PMV-1]
MGIQNFDHSHHKLKIRGLKSPVDVLTFTGHEQLSSPFRYDIQFTSSDKAIAPESVLMQDGAFSLTAPPVQ
GMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLFDGETEAVWGLNTAYSVVEKNVTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDAWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VLDMTDALAQLREAQSLVEALCSATEVAKAELADLQTQKVMMSEALEELKKSAMLLSAPEGIAQVTPKSL
QLSAGENIISTSGKNSDFSVLKKFTVAAGETVSLFAQKLGIKIFAGKGKVEIQAQGDEMLLDALKDIRIS
SSEGRILISAKNEIILTSGGGYIRIGDGTVECAAPDKIIERGAVWQKFSGQSISQAMQQWDSADFAVTPE
ILWQQTGKPAKNQKVQVTRGDGSVVEMTTDEQGRLPIQSGLFVESIKIDLPDSQEN
 
Nucleotide Sequence: 2481 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3154063-3156543 Escherichia coli PMV-1 main chromosome, complete genome
ATGGGTATTCAGAATTTCGACCACTCACACCACAAGCTCAAAATTCGCGGCCTGAAAAGCCCGGTGGACG
TGCTGACTTTTACAGGCCACGAACAGCTCAGCTCACCCTTCCGCTACGACATTCAGTTTACCAGCAGCGA
TAAAGCCATCGCGCCGGAATCGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCCGTACAG
GGAATGCCGGTACAGACTGCCCTGCGCACCCTGCACGGCGTCATTACCGGCTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCGCAGCCGCCAGAA
CGCCATCTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGACACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTATGGCGAGG
ACGACCTGACGTTTGTCTCACGCCTGCTGTCGGAAGTGGGTATCTGGTTCCGCTTCGCCACCGACGCCCG
GCTGAAAATCGAAGTTATCGAATTTTACGACGACCAGAGCGGCTATGAGCGCGGGCTGACGCTGCCGCTT
CGCCATCCTTCTGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGCTGAACACGGCATACAGCGTGG
TGGAGAAAAACGTCACCACGCGGGACTACAACTACCGCACCGCCACAGCGGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCTGACAACTTCCTGCAAAAA
GGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCAGCGGTGTTCCGCAAGGGTGTGCTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTCACGGCGATACCCTACTCAGAACGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACGGTGAAGAACGATATTTATGCCCATAT
CGACAAGGACGGGCGCTACCGGGTCAATCTCGACTTTGACCGCGACGCATGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCACCTGCCGCTGCTGGCGGGAA
CGGAGGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCTTATATTGCAGGCGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTACTGCGTACCCCGGCCAACAACAAA
ATCCGGCTGGATGACGAACGCGGGAAGGAGCATATCAAGGTCAGCACCGAATACGGCGGCAAGAGCCAGC
TAAACCTCGGTCATCTGGTGGATGCCGGGAAACAGCAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGCGCAGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCCGATGCGCAGGACAAGGCGCAGGGTCAG
GTTCTGGATATGACTGATGCACTAGCTCAACTTCGCGAGGCACAGTCTTTGGTAGAGGCACTATGTAGTG
CTACTGAAGTGGCAAAGGCTGAACTTGCAGATTTGCAGACTCAGAAAGTAATGATGTCAGAGGCTCTGGA
GGAACTCAAAAAATCAGCGATGTTGCTTTCGGCTCCGGAAGGAATAGCTCAGGTTACGCCAAAAAGCCTG
CAGCTGTCCGCAGGAGAAAACATCATTAGCACCAGTGGAAAAAATTCAGATTTCAGCGTGTTGAAGAAGT
TTACCGTTGCTGCTGGAGAAACGGTAAGTCTGTTTGCCCAAAAGCTGGGGATAAAAATTTTTGCCGGTAA
GGGAAAAGTAGAGATTCAGGCGCAGGGAGATGAAATGTTGCTAGATGCGCTGAAAGATATCCGCATCAGC
AGCAGTGAGGGGCGAATCCTTATTAGCGCAAAAAACGAAATCATTCTGACCAGCGGCGGCGGATATATTC
GTATTGGTGATGGTACGGTGGAATGCGCAGCCCCAGACAAGATCATAGAGCGTGGGGCCGTATGGCAGAA
GTTCAGCGGCCAGAGCATCAGTCAGGCGATGCAACAGTGGGATTCTGCTGATTTTGCTGTCACACCAGAA
ATACTCTGGCAACAAACTGGCAAACCTGCAAAAAATCAAAAGGTACAGGTCACACGGGGTGATGGCTCAG
TGGTGGAAATGACCACCGATGAACAAGGACGATTGCCCATACAGTCAGGGCTTTTCGTTGAGTCAATAAA
AATTGATCTGCCGGATAGTCAGGAAAACTGA
 Primer design