SecReT6
Protein ID: 544577343
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03086
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3159866..3160126 [+]
Producthypothetical protein
NotePAAR
UniProt IDT2MUK4
KEGG IDecoi:ECOPMV1_03086
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.20E-22, Aligned region: 7..78
Protein Sequence: 86 a.a.     [Download]
>gi|544577343|ref|YP_008572867.1| hypothetical protein ECOPMV1_03086 [Escherichia coli PMV-1]
MPGIVCLGDATTHGGKVITATSTLFINGIQVALVGDLVSCPKHGVNPIQEGDPTATEKGRNVVVNHCQCA
CGCRVISSQPENSIES
 
Nucleotide Sequence: 261 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3159866-3160126 Escherichia coli PMV-1 main chromosome, complete genome
ATGCCTGGGATCGTTTGTTTAGGTGATGCCACGACTCATGGTGGTAAGGTGATTACCGCAACTTCAACGC
TTTTTATCAATGGCATTCAGGTAGCTCTCGTAGGTGATCTGGTTTCCTGCCCAAAGCACGGCGTGAATCC
CATACAAGAAGGTGACCCGACAGCGACGGAAAAAGGTCGTAATGTCGTTGTTAATCATTGCCAATGTGCA
TGTGGCTGTAGGGTTATCAGTTCTCAACCAGAAAATAGTATCGAGTCATAA
 Primer design