SecReT6
Protein ID: 544577346
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03089
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3164593..3166230 [+]
Producthypothetical protein
NoteTssA
UniProt IDT2MUX1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.90E-20, Aligned region: 76..135
Protein Sequence: 545 a.a.     [Download]
>gi|544577346|ref|YP_008572870.1| hypothetical protein ECOPMV1_03089 [Escherichia coli PMV-1]
MRKSMGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNK
LSGTDTGLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFTAWPEDQHSPSLMPLINALESRLAQSGGMN
AVVPQNSSSVTAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAV
IRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LAMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVAIDPARAAVLCDTQHKD
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3164593-3166230 Escherichia coli PMV-1 main chromosome, complete genome
ATGCGGAAGAGTATGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AGACACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATACGCGACGAAATGAACAAA
CTTTCCGGCACAGATACCGGCCTTATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCCAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACT
GGCGCTGCTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGTCCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCACTGCATGGCCCGAAGACCA
GCATTCCCCCTCCCTGATGCCACTGATTAACGCGCTGGAATCACGTCTGGCGCAGTCGGGCGGGATGAAC
GCGGTGGTGCCGCAAAACAGCAGCAGCGTTACTGCACCGTCATCCCCGGTGGATGCGCCACAGGTACAGA
CCATCACCTCCGGGCGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGAT
GTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGCT
GGATATCCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCTGTT
ATCCGTCAGGACCTGGCGTTACTGCTGGAACGCCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGGCA
CGCCGTTCGCCGATGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTACCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGCGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CGGCACGACAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCAGAA
CTGCTGTTTGAAGTAAAAGCCCGGCAACTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAG
CCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTGGCAATCGATCCGGCACGGGCAGCGGT
ACTGTGTGATACGCAACATAAGGACTGA
 Primer design