SecReT6
Protein ID: 544577347
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03090
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3166236..3167813 [+]
ProductPyocin large subunit
NotePAAR
UniProt IDT2MVA5
KEGG IDecoi:ECOPMV1_03090
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.10E-11, Aligned region: 9..66
Protein Sequence: 525 a.a.     [Download]
>gi|544577347|ref|YP_008572871.1| Pyocin large subunit [Escherichia coli PMV-1]
MGTGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGSLD
SQSSCPCKARFIASMMDDTYETDDGGSEPEQHAQSARKNLTSGNPDKKYSHQIKLQHGENNVSVQDIPYV
FILNNNMSLSGKTNQDGETERIYTDTAQKVIALTGKLADSWLKRGKNFGSLKEIDNRKIELTTEENEPVK
YVNWINGRDYIVIVAARTAVTNWIGMEDSKGNQYRFINCGLEQLQQFPPASKQDSSSQRIMVVFSLGYTQ
KDIDRINDYTKAHDGRIIYVKNKDELVSFLNQRKEKGRVIKELVILCHGVIKTASYHYHHEDKDIEKNGM
FKHEDIAAVHESVFDYDAHVTTYACRAGISDGDKDFSGKDDAGQKDSPAQKMADNWDVMVKAFEMRSDYS
LAYGTGKEIKEAQEYGSVVEKYKKDIDMYNKEKAKGNTEVSPPVKPEGYDEKSKRHADVTTRDKNEKSGG
GPIAPNGAWHMPRTGDSPKGLKSGLQDYQPEEWVQ
 
Nucleotide Sequence: 1578 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3166236-3167813 Escherichia coli PMV-1 main chromosome, complete genome
ATGGGAACAGGCTACTTTCTGGTCAGGGGGGACAAAACCACCTGCGGCGGGAAGATTATTGAAGGCGCGG
ACGACCATACGATCATGGGTATCCCACAGGCACGGGATATGGATCGGGTCACCTGCGGCAGATATCCGGG
AATGTTTATTATTGTGGGCGGCGTGCCGGAAACGGATATTCACGGCAGGCTGATGGCGGGATCTCTGGAC
AGCCAGAGCAGTTGCCCGTGCAAGGCGCGGTTTATTGCGTCAATGATGGATGATACCTATGAAACGGATG
ACGGGGGAAGCGAGCCGGAACAACATGCGCAGTCGGCGAGGAAAAATCTGACTTCCGGTAATCCAGATAA
AAAATACAGTCATCAGATAAAACTTCAACATGGCGAAAATAATGTTAGTGTACAGGACATACCTTATGTC
TTTATCCTAAATAATAACATGTCTCTCAGTGGCAAGACTAATCAGGATGGCGAGACTGAGAGAATATATA
CAGATACTGCTCAAAAGGTAATTGCACTTACAGGAAAACTGGCTGATTCCTGGCTGAAAAGAGGGAAAAA
TTTTGGTTCATTAAAAGAAATTGACAATAGAAAGATCGAATTAACAACTGAAGAGAATGAACCTGTAAAA
TATGTCAACTGGATTAATGGGCGTGATTATATTGTGATTGTGGCGGCCAGAACAGCCGTAACAAACTGGA
TAGGAATGGAGGACTCAAAAGGAAATCAGTATCGATTTATAAATTGTGGATTAGAACAATTACAACAGTT
TCCTCCAGCCAGTAAACAGGATTCCAGTTCGCAGCGAATTATGGTGGTTTTTTCGCTTGGGTATACGCAA
AAAGATATTGATAGAATTAATGATTATACTAAAGCGCACGATGGAAGAATTATCTATGTCAAGAATAAGG
ATGAATTAGTTTCATTCCTGAATCAACGCAAAGAAAAAGGAAGAGTGATTAAGGAACTGGTTATTCTGTG
CCACGGTGTTATTAAAACAGCTTCATATCATTATCATCATGAAGACAAGGATATTGAAAAAAATGGAATG
TTTAAACATGAAGATATTGCAGCAGTTCACGAGTCAGTTTTTGATTATGATGCCCATGTGACAACATATG
CCTGTCGGGCCGGTATCTCAGATGGTGATAAAGATTTTTCCGGGAAGGATGATGCAGGGCAAAAGGACAG
CCCGGCACAGAAAATGGCTGATAACTGGGATGTCATGGTTAAAGCGTTTGAGATGAGATCGGACTACAGT
CTGGCTTATGGGACAGGCAAGGAAATTAAAGAAGCTCAGGAATATGGTAGTGTGGTAGAAAAATATAAAA
AAGATATAGATATGTATAATAAAGAAAAAGCAAAGGGGAATACTGAAGTTTCCCCTCCAGTGAAACCAGA
GGGATATGATGAGAAATCAAAACGCCATGCAGATGTTACTACCAGAGACAAAAATGAAAAGTCTGGCGGA
GGACCAATAGCTCCTAATGGTGCATGGCATATGCCAAGAACAGGGGATTCGCCGAAAGGGCTGAAAAGCG
GGTTACAGGATTATCAGCCTGAGGAGTGGGTTCAATAA
 Primer design