SecReT6
Protein ID: 544577350
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03093
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3169512..3171272 [+]
Producthypothetical protein
NoteTssF
UniProt IDT2MUC3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.60E-186, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|544577350|ref|YP_008572874.1| hypothetical protein ECOPMV1_03093 [Escherichia coli PMV-1]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCVYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQDR
RMLGAHFSPMGFEDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLEQVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDSDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3169512-3171272 Escherichia coli PMV-1 main chromosome, complete genome
ATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAATTCG
CACAGGCGTATCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGATCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCCCACTACCTGCGAACCATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGCGGCCCGC
TGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCCCGGTAGC
CTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCAGGATCGC
CGGATGCTTGGCGCACACTTTTCCCCGATGGGCTTTGAGGATGATGACAGGCTCTGGCCAAAAGGTGAGT
CAGCCTTCAGCGGTTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTCGTGGCGCT
GAACGGGCTGGAGCAGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAACCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCA
TATGTCCCCTTTTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGCTTGCACGACACATGGCTGATTCTGGGCGGCGATGCGTTTGA
TTCCGACCGGATGCTGGAGGATGAAACCCTGTCCTTAAGTCTGACCGGCACCAACGGGCAGCTTCCCCGT
AAAGCCTTACAGAGCACCCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCGACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
CGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTCTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA
 Primer design