SecReT6
Protein ID: 544577354
SecReT6 ID853
T6SS typei2
Gene symbol-
Locus tagECOPMV1_03097
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3173264..3174640 [+]
Producthypothetical protein
NoteTssA
UniProt IDT2MVE2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 5.80E-17, Aligned region: 42..100
Protein Sequence: 458 a.a.     [Download]
>gi|544577354|ref|YP_008572878.1| hypothetical protein ECOPMV1_03097 [Escherichia coli PMV-1]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLSLALFRQNGVELQTLVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
STIETTLQQCELWHMTKLDVLSGQFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFAT
RSVQQNDKDASPPVPSPEISRQRTWPIFMAGMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3173264-3174640 Escherichia coli PMV-1 main chromosome, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACGTATAAGGAATCCG
GTGAACTGCAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGGCCAGACGTGGACTGGCGCCAAGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAACTACAGACGCTGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGATATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGCTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATCTACCGTTGTGTACAGCATCTT
TCTACCATAGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAGCTGGACGTATTGTCCGGGC
AGTTTCGCAATACCGCATTGCGTCTGGAACGGCTGGCGCCTCAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAATCAACCGAAAAAGTCAGAGGAAAGTCCACAGCCGGTTTTTGCAACC
AGATCCGTTCAGCAAAACGATAAGGATGCCAGTCCACCCGTTCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCGGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCGCTAATCCAGCGAATACAACTGTCTGTCATGCCGTTGCCGCAGTCGCTG
GAGAGCGGCGAACTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAAGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGGGCGCTGAACGCGCAGTGGCGCAAA
CAGCGGGAGCTGAGCGCCCTGTCTGCTGAGGCACTGAATGGCTATGCTCAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAACGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCAACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGTTGA
ATCGCTATGTCATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA
 Primer design