SecReT6
Protein ID: 549478378
SecReT6 ID854
T6SS typei3
Gene symbol-
Locus tagIA1_01510
StrainSalmonella enterica subsp. enterica serovar Thompson str. RM6836
Repliconchromosome [GenBank: NC_022525] [Browse all T6SS(s) in this replicon]
Location [Strand]337943..341812 [+]
Productmembrane protein
NoteTssM
UniProt IDV5KF36
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.50E-93, Aligned region: 588..916
ImcF-related_N [PF14331], Evalue: 2.90E-92, Aligned region: 263..541
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 446..482
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 1025..1146
Protein Sequence: 1289 a.a.     [Download]
>gi|549478378|ref|YP_008612127.1| membrane protein [Salmonella enterica subsp. enterica serovar Thompson str. RM6836]
MQKFLSLLFSRRALAVVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVLWLVNWSMSII
GISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEE
VPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGL
QFPLAEQMEQTSRILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRK
HRPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRT
LTSHLRAQIWGFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREF
AALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIKTARGESSASL
PHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDY
LNEISARATRLDGDVKAYTGKPAMAPVPALLDSARELSAWPELDPDAPPLTWRYGLYSVPPVTDSVASLY
NRLLDQLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDS
VAGFGGRAAVLTHIEALFDGSRVVHSPYEKDEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLV
RAVGADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRS
QIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAV
VEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQ
SGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTRKI
NAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDP
WRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAH
GPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRR
VVLEITAGRDFNPVSRELLQNFSCPARAL
 
Nucleotide Sequence: 3870 bp     [Download]
>gi|549478129|ref|NC_022525.1|:337943-341812 Salmonella enterica subsp. enterica serovar Thompson str. RM6836, complete genome
ATGCAAAAATTTCTTAGTCTGCTTTTTTCCCGGCGCGCGCTGGCAGTTGTGGGCGTTCTGGTTCTGGCGC
TGCTGGTCTGGTTTGTCGGGCCGCTGGTGTCATTTGATACCCTGCGCCCGCTGGCCTCCGTGGGTAGCCG
GGTAGTGACCATTGCCCTGTTGCTGATGCTGCTGGTACTGTGGCTGGTCAACTGGTCGATGAGTATCATC
GGCATCAGTGTCCTGTGCCTGGCGATTGGCTTCGTCACACCGCTGCTGGCCCTGGGCGATGTCCATCCGT
TTGCGCCGCTGTGGGTCCGCCTGACATTAATTGGTTTCATCCTGCTGATGTACGCGCTGTACGGCCTGTA
CCGGCTGTGGCGTGCGCTGCGTATGGATGAACAACTGCTGCGTCGCTTCCTGCATCCGCGCGGGGAAGAG
GTACCGGTGGCTGGCGAGATCAAAGCCGACCTGCGCACCGTCAACCATATTGTCACGCAGGCCATCCGGC
AACTGCGGCAGTTGCGGGTGGACATGCCCGGCTGGCGTAAAATCTTCGAGGGAAAACGCTTTCTGTATGA
GCTGCCGTGGTTCATGGTGGTCGGCAGTCCCGGCGATGGCAAAACCACGGCCCTGCTGAACACCGGATTG
CAGTTCCCGCTGGCGGAGCAAATGGAGCAGACCTCGCGTATCCTGACAGTACCGGGTGGCGGCACGCTAC
ACTGCGACTGGTGGTTTACCAACGAAGCGGTGTTGATTGATACCGCCGGACGCTACGCCCGCCACGATGA
CGGCGGCGAAGCGAGCGCCGCGCAGCGTAACGCCGGAGAGTGGCAGGGCTTTCTCGGTCTGCTGCGTAAA
CATCGCCCCGGCGCGCCGCTTAACGGCGTGATCCTGACGCTAAACGTGGCGGATTTAACCGCACAGTCAC
CGGCGGAACGCCTGGCGGCCTGCGCCGCTCTGCGGGCGCGACTGGCAGAACTGCGCGAGACCCTGGGGAT
TCGCTTTCCGGTCTATCTGGTGGTCACCAAAATGGATTTGTTGCCGGGGTTCAGCGAATATTTTCGCACG
CTGACCAGCCATCTTCGTGCACAAATCTGGGGCTTCACGTTGCCGTACAGCCGCAGGCGAAAAGCGGGCG
ACCCGCAGGCGCTGCACGCCGCCTGCGCGCAGGAGCTGGCGCGCCTGACGCTGCGGTTGGATCAGGGACT
GGATACCCGGTTACAGGAAGAGTACGACCTTAAAAGCCGCCAGCGGCTGTATACCTTCCCGCGTGAGTTC
GCCGCCCTCGGCGAGCCGTTGCTGGAGGCTATTGAACAGATCTTCCTCGATTCAAAATTCGATGCCACGC
AACTGAATAACACGCTGCGCGGGGTGTTTTTCACCAGCGCCGCGCAGGCGCAGGCCGACGCCGTGGCCGA
CCAGTTGAGTATCTGGCAGCGCTTTGTCCGGGCGATAAAAACCGCCCGTGGCGAATCCTCCGCCTCTCTC
CCACACGCTCTGCCGGACGGCAACCGCAGCTACTTCCTGCATGACCTGCTGACACAGTTTATTTTTCGTG
AAGCGCACCTGGTGGAGCCAAACCTCCAGTGGGCCTGGCGTTACCGCCTGCTGCGCCTCGGCGGGCACCT
GCTGGTACTGGTGCTGGCATTCCTGTTGTGGCAGGGGATGCAGACCAGCCAGCAGACCAACGGCGACTAT
CTGAATGAAATCAGCGCCCGCGCGACCCGGCTGGACGGTGATGTGAAAGCCTACACCGGTAAACCGGCGA
TGGCTCCCGTCCCGGCACTGCTGGACAGCGCAAGGGAACTGTCCGCCTGGCCGGAACTGGACCCGGACGC
GCCGCCGCTGACCTGGCGCTACGGCCTGTACAGCGTACCGCCGGTAACCGACAGCGTGGCGTCGCTGTAC
AACCGCCTGCTGGATCAACTGCTGCTGCCGCCGCTGGTGAAACGGATGGAGTATGTGCTGGCGGACGCCA
TTGCCCGTCAGGATAGTAAAGCGGCCTACGATGCCCTGCGCATCTATCTGCTACTGAATCTGGATAAAGA
TCACGAAGATAAATACAACGCGGCGGAGATCCAGTCGTGGGTGATTAACGATCTGGGGAACAGCGACAGC
GTGGCCGGGTTCGGCGGGCGCGCCGCCGTGCTGACGCATATCGAAGCGCTGTTTGACGGCAGCCGGGTGG
TGCATTCACCGTATGAGAAAGATGAGGCGCTGATCCGCCAGGCGCGGGCATTCCTCGACGGTCACACCAG
TACCGAGCGTATCTACGCGCGGGCGCTGGCGGCGATGGAGAGCGAAGCGCCGCAGGAGTTCACGCTGGTA
CGCGCCGTCGGCGCGGATGCGGGAACGGTGTTTGTGCGTAGCAACGGCGCGCCGCTGGATCGGGGCGTGC
CGGGTATTTTTACCCGTGAAGGATACCGGGAGCTGTTCGACAAACGATTACCGGAATTTGTGGCGGCGGC
GACGGCGAACGATGGCTGGGTGATGGGCCGGGAGAGTACGCCAAAAAAGCTGACTGACAGCCTGCGCAGC
CAGATACCGGGGCAGGAGCAGTCTGTCGCCCGCGAAGTCCGCCGTTTGTACCTGACGGAATATGCCCGCC
GCTGGCAGGATTTTCTGGACAGTATCCATAGTATCAACAGTGCCGGGGAAGAGGGCAGTTCCGGCCTGGC
TTATGATTTACAGGTGCTGCGCACCCTGGCGTCGCCGGACTCACCGCTGATGCGGCTGGGAAAAGCGGTG
GTGGAGCAGACCACGCTGGTGCCGCCGCCGGACCCGCAGGCCAGACAGAAACAACTGGCGCAGCGCGCAT
CCGGTAACGCGGGGAAAGTGGTACAGACGGCAAAACTGTTCCAGGATATTCACCCGGAAGAACGGCTGGA
AAAAACGCTGGTGGATGATCGTTTCGCCGCGCTGCGCGAGGTCATTGCCGGGCGGACGGACGGCGGACAG
AGCGGCGGTGGGACGATGCAGATCGCTTCGCTGCTGACCATGCTCAACGAGTATTACACCCAACTGACCA
TTGCTGATAGCGCGCTGGCGGCGGGGACGTTGCCAGCGCGCATTACTGCCGCAGACAAGTTGCAACTGGA
GGCGGCGAAACTGCCTGCGCCGCTGAAAAACATCCTGCTGGATCTGACGAAGCAGGGAACGCGCAAAATC
AACGCCGGGACCGGCGACGTGCTGAACACCCAGATGGAGGCGATGATGGGCGACGACTGCCGTGACGCCA
TCGACGGGCGTTATCCGTTCGCCGACAGCCCGCAGGAGGTCAGCGCCGAGGACTTTAACCGCATCTTCGC
CAGCGGCGGCGTACTGGATGCTTTCTGGAGCAAACAACTGGCTCCGCTGGCGGACACCGCCAGCGACCCG
TGGCGCTACAAACCGACCGAAGGCAACATGACATTGCAGGGGCCGGATTTAACGCCGTTTCAGCAGGCGA
AGCAGATCCGCAGCGTGTTTTTTAACAGCGAGGGCGGGAAAAAATTTTCCTGGTCGATGCAGATTAGCGT
GGTGGATATGGACCCGGCCATCACGGAACTGGTGATTGATATCGACGGCCAGGTGCTGCGCTACGCCCAT
GGTCCGGACCGGCCCCTGAAAGTGACGTGGCCGGGACCGCGCAACGGCTCGATGGCGGAAATCACCGCCA
GCCCGCGTATTCGCCAGGACACCTCAACGCTACTGACCGGCGGGCCGTGGGCGCTGTTTCATCTGCTGGA
CGCCGGAATGGTACAGGAAACGGCGGTGCGGGGGCGCCAATTGGTGGAATATGATTTTGACGGTCGCCGG
GTGGTGCTGGAAATCACTGCCGGGCGGGATTTTAACCCGGTCAGCCGGGAGCTGTTGCAGAACTTCAGTT
GCCCGGCGAGGGCGCTGTAA
 Primer design